Library    |     Search    |     Batch query    |     SNP    |     SSR  

TrEMBL blast output of UN00339


BLASTX 7.6.2

Query= UN00339 /QuerySize=989
        (988 letters)

Database: UniProt/TrEMBL;
          11,397,958 sequences; 3,661,877,547 total letters
                                                                  Score    E
Sequences producing significant alignments:                       (bits) Value

tr|Q9FYH8|Q9FYH8_ARATH F17F8.22 OS=Arabidopsis thaliana GN=At1g3...    554   7e-156
tr|B9GYG0|B9GYG0_POPTR Predicted protein OS=Populus trichocarpa ...    450   2e-124
tr|A9PHV7|A9PHV7_POPTR Putative uncharacterized protein OS=Popul...    446   2e-123
tr|B9SQ70|B9SQ70_RICCO Molybdopterin cofactor sulfurase, putativ...    423   2e-116
tr|B9SQ73|B9SQ73_RICCO Molybdopterin cofactor sulfurase, putativ...    393   3e-107
tr|B6T4E6|B6T4E6_MAIZE Mo-molybdopterin cofactor sulfurase OS=Ze...    388   7e-106
tr|C4J336|C4J336_MAIZE Putative uncharacterized protein OS=Zea m...    386   3e-105
tr|C5X8E3|C5X8E3_SORBI Putative uncharacterized protein Sb02g032...    382   3e-104
tr|C6TLQ6|C6TLQ6_SOYBN Putative uncharacterized protein OS=Glyci...    377   9e-103
tr|O48588|O48588_ARATH Putative uncharacterized protein At5g4472...    377   1e-102
tr|Q8LA63|Q8LA63_ARATH Putative uncharacterized protein OS=Arabi...    376   2e-102
tr|B8BEF4|B8BEF4_ORYSI Putative uncharacterized protein OS=Oryza...    369   3e-100
tr|Q653D7|Q653D7_ORYSJ Molybdenum cofactor sulfurase protein-lik...    366   2e-099
tr|Q0MRQ7|Q0MRQ7_ORYSJ Molybdenum cofactor sulfurase-like protei...    364   1e-098
tr|Q653D6|Q653D6_ORYSJ Molybdenum cofactor sulfurase protein-lik...    362   3e-098
tr|A9NM27|A9NM27_PICSI Putative uncharacterized protein OS=Picea...    361   9e-098
tr|Q3E8H2|Q3E8H2_ARATH Putative uncharacterized protein At5g4472...    306   3e-081
tr|B8BEF5|B8BEF5_ORYSI Putative uncharacterized protein OS=Oryza...    260   3e-067
tr|C0P5S5|C0P5S5_MAIZE Putative uncharacterized protein OS=Zea m...    219   6e-055
tr|D2QLE2|D2QLE2_SPILD MOSC domain containing protein OS=Spiroso...    182   8e-044

>tr|Q9FYH8|Q9FYH8_ARATH F17F8.22 OS=Arabidopsis thaliana GN=At1g30910/F17F8_22
        PE=2 SV=1

          Length = 318

 Score =  554 bits (1426), Expect = 7e-156
 Identities = 267/318 (83%), Positives = 289/318 (90%), Gaps = 4/318 (1%)
 Frame = -1

Query: 949 MENA----LSPSRAGEIAGRVASLYVYPIKSCRGISLSQASLTPTGFRWDRNWLIVNSKG 782
           MEN     LSPS A E+A RV+SL+VYPIKSCRGISLSQA+LTPTGFRWDRNWLIVNSKG
Sbjct:   1 MENTLSPLLSPSPASEVAARVSSLFVYPIKSCRGISLSQAALTPTGFRWDRNWLIVNSKG 60

Query: 781 RGLTQRVEPKLSLIEVEMPKHAFAQDWQPDNNSNMLVRAPGMDVLKVSLAKPEKTADGVS 602
           RGLTQRVEPKLSLIEVEMPKHAF +DW+P+ +SNM+VRAPGMD LKVSLAKP+K ADGVS
Sbjct:  61 RGLTQRVEPKLSLIEVEMPKHAFGEDWEPEKSSNMVVRAPGMDALKVSLAKPDKIADGVS 120

Query: 601 VWEWFGSALDEGEEASNWFSEFVGKPCRLVRFDSASETRPVDPNYAPGHFAMFSDMYPFL 422
           VWEW GSALDEGEEAS WF+ FVGKPCRLVRF+SA ETRPVDPNYAPGH AMFSDMYPFL
Sbjct: 121 VWEWSGSALDEGEEASQWFTNFVGKPCRLVRFNSAYETRPVDPNYAPGHIAMFSDMYPFL 180

Query: 421 LISQGSLDALNELLMEPVPINRFRPNILVDGCELFAEDLWTEILIDNFTFHGVKLCSRCK 242
           LISQGSLD+LN+LL EPVPINRFRPNI VDGCE FAEDLWTEILI+ FTFHGVKLCSRCK
Sbjct: 181 LISQGSLDSLNKLLKEPVPINRFRPNIFVDGCEPFAEDLWTEILINGFTFHGVKLCSRCK 240

Query: 241 VPTINQDTGVGGEEPIETLRSFRSDKFLQPQKKPQGKIYFGQNMVWKDGFGDGIAKTIEI 62
           VPTI+Q+TG+GG+EPIETLR+FRSDK LQP+ KP GKIYFGQNMVWKDGFGDGI KTIEI
Sbjct: 241 VPTISQETGIGGQEPIETLRTFRSDKVLQPKSKPHGKIYFGQNMVWKDGFGDGIGKTIEI 300

Query:  61 GDSVLVLGKHSFPIEAAT 8
           GDSV+VL K S P EAAT
Sbjct: 301 GDSVVVLRKLSSPAEAAT 318

>tr|B9GYG0|B9GYG0_POPTR Predicted protein OS=Populus trichocarpa
        GN=POPTRDRAFT_646882 PE=4 SV=1

          Length = 304

 Score =  450 bits (1155), Expect = 2e-124
 Identities = 208/302 (68%), Positives = 249/302 (82%)
 Frame = -1

Query: 916 EIAGRVASLYVYPIKSCRGISLSQASLTPTGFRWDRNWLIVNSKGRGLTQRVEPKLSLIE 737
           E   +V+S+++YP+KSCRGISLSQA LTPTGFRWDRNWL+VN +GR  TQRVEPKL+L+E
Sbjct:   2 EATAKVSSIFIYPVKSCRGISLSQAPLTPTGFRWDRNWLVVNYRGRAYTQRVEPKLALVE 61

Query: 736 VEMPKHAFAQDWQPDNNSNMLVRAPGMDVLKVSLAKPEKTADGVSVWEWFGSALDEGEEA 557
           +E+P  AF++ W+P  NS M ++APGM VLK+SL KP + A+GVSVWEW GSALDEG EA
Sbjct:  62 IELPDEAFSEGWEPTKNSFMKIKAPGMSVLKISLMKPSEVAEGVSVWEWSGSALDEGAEA 121

Query: 556 SNWFSEFVGKPCRLVRFDSASETRPVDPNYAPGHFAMFSDMYPFLLISQGSLDALNELLM 377
           + WFS+++GKP +LVRF++ASETR +DPNYAPGH  MFSD++PF+LISQGSLDALN+LL 
Sbjct: 122 AKWFSDYLGKPSQLVRFNAASETRLIDPNYAPGHKTMFSDLFPFMLISQGSLDALNQLLR 181

Query: 376 EPVPINRFRPNILVDGCELFAEDLWTEILIDNFTFHGVKLCSRCKVPTINQDTGVGGEEP 197
           EPVPINRFRPNILV+GCE F+EDLWTEI I  FTF GVKLCSRCKVPTINQDTG+GG EP
Sbjct: 182 EPVPINRFRPNILVEGCEPFSEDLWTEIRISRFTFEGVKLCSRCKVPTINQDTGIGGTEP 241

Query: 196 IETLRSFRSDKFLQPQKKPQGKIYFGQNMVWKDGFGDGIAKTIEIGDSVLVLGKHSFPIE 17
            ETL   RSDK L+P KK QGKIYFGQN+VWK+   +G  K + +GD V VL K S   E
Sbjct: 242 NETLMKIRSDKVLRPDKKQQGKIYFGQNLVWKENPSEGHGKIVNVGDPVFVLKKVSSVAE 301

Query:  16 AA 11
           AA
Sbjct: 302 AA 303

>tr|A9PHV7|A9PHV7_POPTR Putative uncharacterized protein OS=Populus trichocarpa
        PE=2 SV=1

          Length = 325

 Score =  446 bits (1146), Expect = 2e-123
 Identities = 204/294 (69%), Positives = 245/294 (83%)
 Frame = -1

Query: 916 EIAGRVASLYVYPIKSCRGISLSQASLTPTGFRWDRNWLIVNSKGRGLTQRVEPKLSLIE 737
           E   +V+S+++YP+KSCRGISLSQA LTPTGFRWDRNWL+VN +GR  TQRVEPKL+L+E
Sbjct:   2 EATAKVSSIFIYPVKSCRGISLSQAPLTPTGFRWDRNWLVVNYRGRAYTQRVEPKLALVE 61

Query: 736 VEMPKHAFAQDWQPDNNSNMLVRAPGMDVLKVSLAKPEKTADGVSVWEWFGSALDEGEEA 557
           +E+P  AF++ W+P  NS M ++APGM VLK+SL KP + A+GVSVWEW GSALDEG EA
Sbjct:  62 IELPDEAFSEGWEPTKNSFMKIKAPGMSVLKISLMKPSEVAEGVSVWEWSGSALDEGAEA 121

Query: 556 SNWFSEFVGKPCRLVRFDSASETRPVDPNYAPGHFAMFSDMYPFLLISQGSLDALNELLM 377
           + WFS+++GKP +LVRF++ASETR +DPNYAPGH  MFSD++PF+LISQGSLDALN+LL 
Sbjct: 122 AKWFSDYLGKPSQLVRFNAASETRLIDPNYAPGHKTMFSDLFPFMLISQGSLDALNQLLR 181

Query: 376 EPVPINRFRPNILVDGCELFAEDLWTEILIDNFTFHGVKLCSRCKVPTINQDTGVGGEEP 197
           EPVPINRFRPNILV+GCE F+EDLWTEI I  FTF GVKLCSRCKVPTINQDTG+GG EP
Sbjct: 182 EPVPINRFRPNILVEGCEPFSEDLWTEIRISRFTFEGVKLCSRCKVPTINQDTGIGGTEP 241

Query: 196 IETLRSFRSDKFLQPQKKPQGKIYFGQNMVWKDGFGDGIAKTIEIGDSVLVLGK 35
            ETL   RSDK L+P KK QGKIYFGQN+VWK+   +G  K + +GD V VL K
Sbjct: 242 NETLMKIRSDKVLRPDKKQQGKIYFGQNLVWKENPSEGHGKIVNVGDPVFVLKK 295

>tr|B9SQ70|B9SQ70_RICCO Molybdopterin cofactor sulfurase, putative OS=Ricinus
        communis GN=RCOM_1195950 PE=4 SV=1

          Length = 304

 Score =  423 bits (1086), Expect = 2e-116
 Identities = 202/302 (66%), Positives = 236/302 (78%)
 Frame = -1

Query: 916 EIAGRVASLYVYPIKSCRGISLSQASLTPTGFRWDRNWLIVNSKGRGLTQRVEPKLSLIE 737
           E A +VAS+++YPIKSCRGIS+SQASL PTGFRWDRNWL+VNSKGR  TQRVEPKL+L+E
Sbjct:   2 EPAAKVASIFIYPIKSCRGISVSQASLAPTGFRWDRNWLVVNSKGRAYTQRVEPKLALVE 61

Query: 736 VEMPKHAFAQDWQPDNNSNMLVRAPGMDVLKVSLAKPEKTADGVSVWEWFGSALDEGEEA 557
           VE+P  A    W+P  NS M ++AP M VLK+ LAK  + AD +SVWEW GSALDEG EA
Sbjct:  62 VELPHEACLDGWEPTANSFMEIKAPRMGVLKIPLAKAHEVADNISVWEWSGSALDEGAEA 121

Query: 556 SNWFSEFVGKPCRLVRFDSASETRPVDPNYAPGHFAMFSDMYPFLLISQGSLDALNELLM 377
           + WFS+F+GKP RLVRF++ASETR VDPNYA GH  MFSD YPFLL+SQGSLDALN+LL 
Sbjct: 122 ARWFSDFLGKPSRLVRFNAASETRAVDPNYARGHRVMFSDGYPFLLLSQGSLDALNKLLK 181

Query: 376 EPVPINRFRPNILVDGCELFAEDLWTEILIDNFTFHGVKLCSRCKVPTINQDTGVGGEEP 197
           EPVP+NRFRPNI +DGCE F+EDLWTEI I+ +TF GVKLCSRCKVPTI+Q TGV   EP
Sbjct: 182 EPVPVNRFRPNIFIDGCEPFSEDLWTEIRINKYTFEGVKLCSRCKVPTIDQATGVASSEP 241

Query: 196 IETLRSFRSDKFLQPQKKPQGKIYFGQNMVWKDGFGDGIAKTIEIGDSVLVLGKHSFPIE 17
             TL   RSD  L+P KK QGKIYFGQN+VWKD    G    +++GD V V+   S   E
Sbjct: 242 NGTLMKIRSDNVLRPSKKQQGKIYFGQNLVWKDNLNGGKGNIVKLGDPVFVVKNVSSAAE 301

Query:  16 AA 11
           AA
Sbjct: 302 AA 303

>tr|B9SQ73|B9SQ73_RICCO Molybdopterin cofactor sulfurase, putative OS=Ricinus
        communis GN=RCOM_1196080 PE=4 SV=1

          Length = 304

 Score =  393 bits (1007), Expect = 3e-107
 Identities = 176/292 (60%), Positives = 230/292 (78%)
 Frame = -1

Query: 904 RVASLYVYPIKSCRGISLSQASLTPTGFRWDRNWLIVNSKGRGLTQRVEPKLSLIEVEMP 725
           +V S+++YP+KSCRGIS+S A LTPTGFRWDRNW+++N +GR  TQR EP+L+L+EVE+P
Sbjct:   6 KVLSIFIYPVKSCRGISVSHAPLTPTGFRWDRNWMVLNDRGRARTQRNEPRLALVEVELP 65

Query: 724 KHAFAQDWQPDNNSNMLVRAPGMDVLKVSLAKPEKTADGVSVWEWFGSALDEGEEASNWF 545
           + AF  DW+P  +S M+++APGM VLK+SLAKP++ +DGVS+WEW GSALDEG EA+ WF
Sbjct:  66 QEAFLDDWEPTKDSYMVIKAPGMPVLKISLAKPQEISDGVSIWEWCGSALDEGVEAAKWF 125

Query: 544 SEFVGKPCRLVRFDSASETRPVDPNYAPGHFAMFSDMYPFLLISQGSLDALNELLMEPVP 365
           S+++GKP  LVRF+S  E RPV  NYAPGH  MF+D  P+L+ S+GSLD LN+ L EPV 
Sbjct: 126 SDYLGKPSWLVRFNSGLEIRPVVDNYAPGHKVMFTDFGPYLVASKGSLDELNKHLKEPVS 185

Query: 364 INRFRPNILVDGCELFAEDLWTEILIDNFTFHGVKLCSRCKVPTINQDTGVGGEEPIETL 185
           INRFRP+IL+DGCE F+EDLW E+ I+ FTF GVKLC+RCK+PTI+Q+TGV G EP  TL
Sbjct: 186 INRFRPSILIDGCEPFSEDLWKEVRINKFTFEGVKLCARCKIPTIDQETGVAGTEPNATL 245

Query: 184 RSFRSDKFLQPQKKPQGKIYFGQNMVWKDGFGDGIAKTIEIGDSVLVLGKHS 29
           +   SDK ++P KK QG++YFG  +VWKD    G    I++GD V +L K+S
Sbjct: 246 KELHSDKTMRPNKKQQGEVYFGHYLVWKDSVDGGKGNIIKVGDPVFLLQKYS 297

>tr|B6T4E6|B6T4E6_MAIZE Mo-molybdopterin cofactor sulfurase OS=Zea mays PE=2
        SV=1

          Length = 321

 Score =  388 bits (995), Expect = 7e-106
 Identities = 181/293 (61%), Positives = 228/293 (77%), Gaps = 1/293 (0%)
 Frame = -1

Query: 919 GEIAGRVASLYVYPIKSCRGISLSQASLTPTGFRWDRNWLIVNSKGRGLTQRVEPKLSLI 740
           GE A  V S+++YPIKSCRG+++SQA +T TGFRWDR W++VN+KGR  TQRVEPKL+L+
Sbjct:  19 GEPAATVKSIFIYPIKSCRGLAVSQAPITSTGFRWDRQWVVVNAKGRAYTQRVEPKLALV 78

Query: 739 EVEMPKHAFAQDWQPDNNSNMLVRAPGMDVLKVSLAKPEKTADGVSVWEWFGSALDEGEE 560
           +VE+P  AFA++WQP  + ++++RAPGMD LK+ L     T D VSVWEW GSA DEG E
Sbjct:  79 QVELPPEAFAENWQPTPDDHLVIRAPGMDTLKIPLITEHTTIDDVSVWEWSGSAYDEGAE 138

Query: 559 ASNWFSEFVGKPCRLVRFDSASETRPVDPNYAPGHFAMFSDMYPFLLISQGSLDALNELL 380
           AS WFS + GKP RLVRF  ASETRP DP+YA G+  MF+D +PFL+ SQGSLDALNE+L
Sbjct: 139 ASEWFSTYFGKPSRLVRFKEASETRPTDPDYAQGYKIMFTDCFPFLIASQGSLDALNEIL 198

Query: 379 MEPVPINRFRPNILVDGCELFAEDLWTEILIDNFTFHGVKLCSRCKVPTINQDTGVGGEE 200
            EPVP+NRFRPNILVDGC  ++EDLW  I I+N TF GVKLC+RCKVPTINQ+ GV G E
Sbjct: 199 KEPVPMNRFRPNILVDGCHPYSEDLWKTIKINNLTFLGVKLCNRCKVPTINQEDGVPGTE 258

Query: 199 PIETLRSFRSDKFLQPQKKPQGKIYFGQNMVWKDGFGDGIAKTIEIGDSVLVL 41
           P ETL++FRSD+ L+P  K + ++YFGQN+V K+    G  K I++GD V V+
Sbjct: 259 PTETLQTFRSDQVLRPSHKNKRQVYFGQNLVCKESL-SGEGKVIKVGDPVYVV 310

>tr|C4J336|C4J336_MAIZE Putative uncharacterized protein OS=Zea mays PE=2 SV=1

          Length = 321

 Score =  386 bits (990), Expect = 3e-105
 Identities = 180/293 (61%), Positives = 228/293 (77%), Gaps = 1/293 (0%)
 Frame = -1

Query: 919 GEIAGRVASLYVYPIKSCRGISLSQASLTPTGFRWDRNWLIVNSKGRGLTQRVEPKLSLI 740
           GE A  V S++++PIKSCRG+++SQA +T TGFRWDR W++VN+KGR  TQRVEPKL+L+
Sbjct:  19 GEPAATVKSIFIHPIKSCRGLAVSQAPITSTGFRWDRQWVVVNAKGRAYTQRVEPKLALV 78

Query: 739 EVEMPKHAFAQDWQPDNNSNMLVRAPGMDVLKVSLAKPEKTADGVSVWEWFGSALDEGEE 560
           +VE+P  AFA++WQP  + ++++RAPGMD LK+ L     T D VSVWEW GSA DEG E
Sbjct:  79 QVELPPEAFAENWQPTPDDHLVIRAPGMDTLKIPLITEHTTIDDVSVWEWSGSAYDEGAE 138

Query: 559 ASNWFSEFVGKPCRLVRFDSASETRPVDPNYAPGHFAMFSDMYPFLLISQGSLDALNELL 380
           AS WFS + GKP RLVRF  ASETRP DP+YA G+  MF+D +PFL+ SQGSLDALNE+L
Sbjct: 139 ASEWFSTYFGKPSRLVRFKEASETRPTDPDYAQGYKIMFTDCFPFLIASQGSLDALNEIL 198

Query: 379 MEPVPINRFRPNILVDGCELFAEDLWTEILIDNFTFHGVKLCSRCKVPTINQDTGVGGEE 200
            EPVP+NRFRPNILVDGC  ++EDLW  I I+N TF GVKLC+RCKVPTINQ+ GV G E
Sbjct: 199 KEPVPMNRFRPNILVDGCHPYSEDLWKTIKINNLTFLGVKLCNRCKVPTINQEDGVPGTE 258

Query: 199 PIETLRSFRSDKFLQPQKKPQGKIYFGQNMVWKDGFGDGIAKTIEIGDSVLVL 41
           P ETL++FRSD+ L+P  K + ++YFGQN+V K+    G  K I++GD V V+
Sbjct: 259 PTETLQTFRSDQVLRPSHKNKRQVYFGQNLVCKESL-SGEGKVIKVGDPVYVV 310

>tr|C5X8E3|C5X8E3_SORBI Putative uncharacterized protein Sb02g032800 OS=Sorghum
        bicolor GN=Sb02g032800 PE=4 SV=1

          Length = 326

 Score =  382 bits (981), Expect = 3e-104
 Identities = 179/294 (60%), Positives = 224/294 (76%), Gaps = 1/294 (0%)
 Frame = -1

Query: 919 GEIAGRVASLYVYPIKSCRGISLSQASLTPTGFRWDRNWLIVNSKGRGLTQRVEPKLSLI 740
           GE A  V S+++YPIKSCRG+++ QA +  TGFRWDR W++VN+KGR  TQRVEPKL+L+
Sbjct:  22 GEPAATVKSIFIYPIKSCRGLAVPQAPIASTGFRWDRQWVVVNAKGRAYTQRVEPKLALV 81

Query: 739 EVEMPKHAFAQDWQPDNNSNMLVRAPGMDVLKVSLAKPEKTADGVSVWEWFGSALDEGEE 560
           +VE+P  AF +DWQP  + +M +RAPGMD LK+ LA    T D VSVWEW GSA DEG E
Sbjct:  82 QVELPPEAFDEDWQPTPDDHMAIRAPGMDTLKIPLAAEHATIDDVSVWEWSGSAYDEGAE 141

Query: 559 ASNWFSEFVGKPCRLVRFDSASETRPVDPNYAPGHFAMFSDMYPFLLISQGSLDALNELL 380
           A+ WFS + GKP RLVRF  ASETRP DP++A G+   F+D +PFL+ SQGSLDALNE+L
Sbjct: 142 AAEWFSTYFGKPSRLVRFKEASETRPTDPDFAQGYKIAFNDCFPFLIASQGSLDALNEIL 201

Query: 379 MEPVPINRFRPNILVDGCELFAEDLWTEILIDNFTFHGVKLCSRCKVPTINQDTGVGGEE 200
            EPVP+NRFRPNILVDGC  ++EDLW  I I+N TF GVKLC+RCKVPTINQ+ G+ G E
Sbjct: 202 KEPVPMNRFRPNILVDGCHPYSEDLWKTIKINNLTFLGVKLCNRCKVPTINQENGIPGTE 261

Query: 199 PIETLRSFRSDKFLQPQKKPQGKIYFGQNMVWKDGF-GDGIAKTIEIGDSVLVL 41
           P ETL +FRSD+ L+P  K + ++YFGQN+V K+   G G  K I++GD V VL
Sbjct: 262 PTETLLTFRSDQVLRPSHKNKRQVYFGQNLVCKESLSGKGKGKIIKVGDPVYVL 315

>tr|C6TLQ6|C6TLQ6_SOYBN Putative uncharacterized protein OS=Glycine max PE=2
        SV=1

          Length = 315

 Score =  377 bits (968), Expect = 9e-103
 Identities = 183/303 (60%), Positives = 228/303 (75%), Gaps = 3/303 (0%)
 Frame = -1

Query: 910 AGRVASLYVYPIKSCRGISLSQASLTPTGFRWDRNWLIVNSKGRGLTQRVEPKLSLIEVE 731
           A +V+ L++YPIKSCRGIS+S A LTP G RWDR W++VNS+GR  TQRV+PKL+L+EVE
Sbjct:  12 AVKVSRLFIYPIKSCRGISVSYAPLTPAGLRWDREWVVVNSQGRACTQRVDPKLALVEVE 71

Query: 730 MPKHAFAQDWQPDNNSNMLVRAPGMDVLKVSLAKPEKTADGVSVWEWFGSALDEGEEASN 551
           +P  A  +D++P ++S M+++APGM  L + L+K  +  D V+VWEW GSA DEG EAS 
Sbjct:  72 LPNDALVEDFEPTSDSYMVLKAPGMKPLNICLSKQHEVTDAVTVWEWTGSAWDEGAEASQ 131

Query: 550 WFSEFVGKPCRLVRFDSASETRPVDPNYAPG-HFAMFSDMYPFLLISQGSLDALNELLME 374
           WFS+F+GKPC+LVRF+SASE R VDP+Y  G H   FSD YPFLL+SQ SLDALNELL E
Sbjct: 132 WFSDFLGKPCQLVRFNSASEVRQVDPDYVRGQHRTYFSDGYPFLLLSQESLDALNELLKE 191

Query: 373 PVPINRFRPNILVDGCELFAEDLWTEILIDNFTFHGVKLCSRCKVPTINQDTGVGGEEPI 194
            +PINRFRPNILV+GC+ + EDLWTEI I  F+F GVKLCSRCKVPTINQ+TG+ G EP 
Sbjct: 192 RIPINRFRPNILVEGCDPYFEDLWTEIKISRFSFLGVKLCSRCKVPTINQETGIAGFEPT 251

Query: 193 ETLRSFRSDKFLQPQKKPQGKIYFGQNMVWK--DGFGDGIAKTIEIGDSVLVLGKHSFPI 20
            TL   RS K ++P  K + K+YFGQN+VW   D    G  KTI++GD V +LG  S   
Sbjct: 252 GTLMKTRSGKVIRPNAKNKNKVYFGQNLVWNWMDSSVKGSGKTIKVGDPVYILGNVSSAE 311

Query:  19 EAA 11
           EAA
Sbjct: 312 EAA 314

>tr|O48588|O48588_ARATH Putative uncharacterized protein At5g44720
        OS=Arabidopsis thaliana GN=At5g44720 PE=2 SV=1

          Length = 308

 Score =  377 bits (967), Expect = 1e-102
 Identities = 180/303 (59%), Positives = 229/303 (75%), Gaps = 6/303 (1%)
 Frame = -1

Query: 904 RVASLYVYPIKSCRGISLSQASLTPTGFRWDRNWLIVNSKGRGLTQRVEPKLSLIEVEMP 725
           ++ SL +YPIKSCRGIS+ QA++T TGF+WDR WL+VN KGR  TQRVEP L+L+E E+P
Sbjct:   6 KIQSLVIYPIKSCRGISVPQATVTHTGFQWDRYWLVVNYKGRAYTQRVEPTLALVESELP 65

Query: 724 KHAFAQDWQPDNNSNMLVRAPGMDVLKVSLAKPEKTADGVSVWEWFGSALDEGEEASNWF 545
           K AF +DW+P N+S +++RAPGM  LK+ L +P   A+GVS+WEW GSA DEGEEA+ WF
Sbjct:  66 KEAFLEDWEPTNDSLLVIRAPGMSPLKIPLTRPSSVAEGVSMWEWSGSAFDEGEEAAKWF 125

Query: 544 SEFVGKPCRLVRFDSASETRPVDPNYAPGHFAMFSDMYPFLLISQGSLDALNELLMEPVP 365
           S+++GK  RLVRF+  +ETRP  P +A G+   F DM+PFL+ SQGSLD LN LL EPVP
Sbjct: 126 SDYLGKQSRLVRFNKDTETRPSPPEFAAGYSTTFMDMFPFLVASQGSLDHLNTLLPEPVP 185

Query: 364 INRFRPNILVDGCELFAEDLWTEILIDNFTFHGVKLCSRCKVPTINQDTGVGGE-EPIET 188
           INRFRPNILVD C+ F EDLW EI I++  F GV+LCSRCKVPT+NQ+TGV G+ EP ET
Sbjct: 186 INRFRPNILVDNCDPFGEDLWDEIKINDLVFQGVRLCSRCKVPTVNQETGVMGKAEPTET 245

Query: 187 LRSFRSDKFLQPQKKPQGKIYFGQNMVWK----DGFGDGIAKTIEIGDSVLVLGKHSFPI 20
           L  FRSD  L P KKP+GK++FG+ MVW     +  G+G  KTI++GD++ V+ K     
Sbjct: 246 LMKFRSDNVLMPDKKPRGKVFFGKEMVWNWNLTNTEGEG-KKTIKVGDTISVIRKIPSRA 304

Query:  19 EAA 11
           EAA
Sbjct: 305 EAA 307

>tr|Q8LA63|Q8LA63_ARATH Putative uncharacterized protein OS=Arabidopsis thaliana
        PE=2 SV=1

          Length = 308

 Score =  376 bits (965), Expect = 2e-102
 Identities = 180/303 (59%), Positives = 228/303 (75%), Gaps = 6/303 (1%)
 Frame = -1

Query: 904 RVASLYVYPIKSCRGISLSQASLTPTGFRWDRNWLIVNSKGRGLTQRVEPKLSLIEVEMP 725
           ++ SL +YPIKSCRGIS+ QA++T TGF+WDR WL+VN KGR  TQRVEP L+L+E E+P
Sbjct:   6 KIQSLVIYPIKSCRGISVPQATVTHTGFQWDRYWLVVNYKGRAYTQRVEPTLALVESELP 65

Query: 724 KHAFAQDWQPDNNSNMLVRAPGMDVLKVSLAKPEKTADGVSVWEWFGSALDEGEEASNWF 545
           K AF +DW+P N+S +++RAPGM  LK+ L +P   A+GVS+WEW GSA DEGEEA+ WF
Sbjct:  66 KEAFLEDWEPTNDSLLVIRAPGMSPLKIPLTRPSSVAEGVSMWEWSGSAFDEGEEAAKWF 125

Query: 544 SEFVGKPCRLVRFDSASETRPVDPNYAPGHFAMFSDMYPFLLISQGSLDALNELLMEPVP 365
           S+++GK  RLVRF   +ETRP  P +A G+   F DM+PFL+ SQGSLD LN LL EPVP
Sbjct: 126 SDYLGKQSRLVRFKKDTETRPSPPEFAAGYSTTFMDMFPFLVASQGSLDHLNTLLPEPVP 185

Query: 364 INRFRPNILVDGCELFAEDLWTEILIDNFTFHGVKLCSRCKVPTINQDTGVGGE-EPIET 188
           INRFRPNILVD C+ F EDLW EI I++  F GV+LCSRCKVPT+NQ+TGV G+ EP ET
Sbjct: 186 INRFRPNILVDNCDPFGEDLWDEIKINDLVFQGVRLCSRCKVPTVNQETGVMGKAEPTET 245

Query: 187 LRSFRSDKFLQPQKKPQGKIYFGQNMVWK----DGFGDGIAKTIEIGDSVLVLGKHSFPI 20
           L  FRSD  L P KKP+GK++FG+ MVW     +  G+G  KTI++GD++ V+ K     
Sbjct: 246 LMKFRSDNVLMPDKKPRGKVFFGKEMVWNWNLTNTEGEG-KKTIKVGDTISVIRKIPSRA 304

Query:  19 EAA 11
           EAA
Sbjct: 305 EAA 307

>tr|B8BEF4|B8BEF4_ORYSI Putative uncharacterized protein OS=Oryza sativa subsp.
        indica GN=OsI_32387 PE=4 SV=1

          Length = 326

 Score =  369 bits (947), Expect = 3e-100
 Identities = 177/302 (58%), Positives = 224/302 (74%), Gaps = 1/302 (0%)
 Frame = -1

Query: 916 EIAGRVASLYVYPIKSCRGISLSQASLTPTGFRWDRNWLIVNSKGRGLTQRVEPKLSLIE 737
           E A  V S+ +YPIKSCRGIS+ QA +T TGFRWDR W++VNSKGR  TQRVEPKL+L+E
Sbjct:  23 EPAATVRSILIYPIKSCRGISVPQAPITSTGFRWDRQWVVVNSKGRAYTQRVEPKLALVE 82

Query: 736 VEMPKHAFAQDWQPDNNSNMLVRAPGMDVLKVSLAKPEKTADGVSVWEWFGSALDEGEEA 557
           VEMP  AFA++W+P  +S ++VRAPGM+ LK+ L+  +   D VSVWEW G+A DEG EA
Sbjct:  83 VEMPPEAFAEEWRPTVDSYLVVRAPGMEPLKIPLSAEQAIIDDVSVWEWSGAAYDEGAEA 142

Query: 556 SNWFSEFVGKPCRLVRFDSASETRPVDPNYAPGHFAMFSDMYPFLLISQGSLDALNELLM 377
           + WFS + G P RLVRF  ASE RP +P+YA G+  MF+D +PFL+ SQGSLDALNE+L 
Sbjct: 143 AEWFSSYFGNPSRLVRFKEASEIRPTNPDYAQGYKIMFTDCFPFLMASQGSLDALNEVLK 202

Query: 376 EPVPINRFRPNILVDGCELFAEDLWTEILIDNFTFHGVKLCSRCKVPTINQDTGVGGEEP 197
           EPVP+NRFRPNILVDGC  ++EDLW  I I+  TF GVKLC+RCKVPTINQ+ G+ G EP
Sbjct: 203 EPVPMNRFRPNILVDGCHPYSEDLWKTIKINKLTFQGVKLCNRCKVPTINQENGILGTEP 262

Query: 196 IETLRSFRSDKFLQPQKKPQGKIYFGQNMVWKDGF-GDGIAKTIEIGDSVLVLGKHSFPI 20
            ETL +FRSD+ L+P  K + ++YFGQN+V K+     G  + I++ D V VL +     
Sbjct: 263 TETLLTFRSDEVLRPSHKNKRQVYFGQNLVCKESLSAKGKGRIIKVSDPVYVLERFPSSD 322

Query:  19 EA 14
           EA
Sbjct: 323 EA 324

>tr|Q653D7|Q653D7_ORYSJ Molybdenum cofactor sulfurase protein-like OS=Oryza
        sativa subsp. japonica GN=P0635G10.7 PE=4 SV=1

          Length = 324

 Score =  366 bits (939), Expect = 2e-099
 Identities = 176/302 (58%), Positives = 222/302 (73%), Gaps = 1/302 (0%)
 Frame = -1

Query: 916 EIAGRVASLYVYPIKSCRGISLSQASLTPTGFRWDRNWLIVNSKGRGLTQRVEPKLSLIE 737
           E A  V S+ +YPIKSCRGIS+ QA +T TGFRWDR W++VNSKGR  TQRVEPKL+L+E
Sbjct:  21 EPAATVRSILIYPIKSCRGISVPQAPITSTGFRWDRQWVVVNSKGRAYTQRVEPKLALVE 80

Query: 736 VEMPKHAFAQDWQPDNNSNMLVRAPGMDVLKVSLAKPEKTADGVSVWEWFGSALDEGEEA 557
           VEMP  AFA++W+P  +S ++ RAPGMD LK+ L+  +   + VSVWEW GSA DEG EA
Sbjct:  81 VEMPPEAFAEEWRPTADSYLVGRAPGMDPLKIPLSAEQAIINDVSVWEWSGSAYDEGAEA 140

Query: 556 SNWFSEFVGKPCRLVRFDSASETRPVDPNYAPGHFAMFSDMYPFLLISQGSLDALNELLM 377
           + WFS + G P RLVRF   SE RP +P+YA G+  MF+D +PFL+ SQGSLDALNE+L 
Sbjct: 141 AEWFSSYFGNPSRLVRFKEGSEIRPTNPDYAQGYKIMFTDCFPFLMASQGSLDALNEVLK 200

Query: 376 EPVPINRFRPNILVDGCELFAEDLWTEILIDNFTFHGVKLCSRCKVPTINQDTGVGGEEP 197
           EPVP+NRFRPNILVDGC  ++EDLW  I I+  TF GVKLC+RCKVPTINQ+ G+ G EP
Sbjct: 201 EPVPMNRFRPNILVDGCHPYSEDLWKTIKINKLTFQGVKLCNRCKVPTINQENGILGTEP 260

Query: 196 IETLRSFRSDKFLQPQKKPQGKIYFGQNMVWKDGF-GDGIAKTIEIGDSVLVLGKHSFPI 20
            ETL +FRSD+ L+P  K + ++YFGQN+V K+     G  + I++ D V VL +     
Sbjct: 261 TETLLTFRSDEVLRPSHKNKRQVYFGQNLVCKESLSAKGKGRIIKVSDPVYVLERFPSSD 320

Query:  19 EA 14
           EA
Sbjct: 321 EA 322

>tr|Q0MRQ7|Q0MRQ7_ORYSJ Molybdenum cofactor sulfurase-like protein 1 OS=Oryza
        sativa subsp. japonica GN=MCSU1 PE=2 SV=1

          Length = 324

 Score =  364 bits (933), Expect = 1e-098
 Identities = 175/302 (57%), Positives = 221/302 (73%), Gaps = 1/302 (0%)
 Frame = -1

Query: 916 EIAGRVASLYVYPIKSCRGISLSQASLTPTGFRWDRNWLIVNSKGRGLTQRVEPKLSLIE 737
           E A  V S+ +YPIKSCRGIS+ QA +T TGFRWDR W++VNSKGR  TQRVEPKL+L+E
Sbjct:  21 EPAATVRSILIYPIKSCRGISVPQAPITSTGFRWDRQWVVVNSKGRAYTQRVEPKLALVE 80

Query: 736 VEMPKHAFAQDWQPDNNSNMLVRAPGMDVLKVSLAKPEKTADGVSVWEWFGSALDEGEEA 557
           VEMP  AFA++W+P  +S ++ RAPGMD LK+ L+  +   + VSVWEW GSA DEG EA
Sbjct:  81 VEMPPEAFAEEWRPTADSYLVGRAPGMDPLKIPLSAEQAIINDVSVWEWSGSAYDEGAEA 140

Query: 556 SNWFSEFVGKPCRLVRFDSASETRPVDPNYAPGHFAMFSDMYPFLLISQGSLDALNELLM 377
           + WFS + G P RLVRF   SE RP +P+YA  +  MF+D +PFL+ SQGSLDALNE+L 
Sbjct: 141 AEWFSSYFGNPSRLVRFKGGSEIRPTNPDYAQSYKIMFTDCFPFLMASQGSLDALNEVLK 200

Query: 376 EPVPINRFRPNILVDGCELFAEDLWTEILIDNFTFHGVKLCSRCKVPTINQDTGVGGEEP 197
           EPVP+NRFRPNILVDGC  ++EDLW  I I+  TF GVKLC+RCKVPTINQ+ G+ G EP
Sbjct: 201 EPVPMNRFRPNILVDGCHPYSEDLWKTIKINKLTFQGVKLCNRCKVPTINQENGILGTEP 260

Query: 196 IETLRSFRSDKFLQPQKKPQGKIYFGQNMVWKDGF-GDGIAKTIEIGDSVLVLGKHSFPI 20
            ETL +FRSD+ L+P  K + ++YFGQN+V K+     G  + I++ D V VL +     
Sbjct: 261 TETLLTFRSDEVLRPNHKNKRQVYFGQNLVCKESLSAKGKGRIIKVSDPVYVLERFPSSD 320

Query:  19 EA 14
           EA
Sbjct: 321 EA 322

>tr|Q653D6|Q653D6_ORYSJ Molybdenum cofactor sulfurase protein-like OS=Oryza
        sativa subsp. japonica GN=P0635G10.8 PE=2 SV=1

          Length = 319

 Score =  362 bits (929), Expect = 3e-098
 Identities = 175/297 (58%), Positives = 220/297 (74%), Gaps = 4/297 (1%)
 Frame = -1

Query: 910 AGRVASLYVYPIKSCRGISLSQASLTPTGFRWDRNWLIVNSKGRGLTQRVEPKLSLIEVE 731
           A  V S+ VYPIKSCRGIS+ QA++T TG RWDR WL++NS GR  TQRVEPKL+LIEVE
Sbjct:  19 AATVKSIVVYPIKSCRGISVPQAAITSTGLRWDRPWLVMNSAGRAFTQRVEPKLALIEVE 78

Query: 730 MPKHAFAQDWQPDNNSNMLVRAPGMDVLKVSLAKPEKTADGVSVWEWFGSALDEGEEASN 551
           MP+ AF  +WQP  +S+M++RAPG+D LK+ L     T D VS+WEW GSA DEG+EA+ 
Sbjct:  79 MPQEAFT-EWQPTPDSHMVIRAPGLDPLKIPLGAKRATVDDVSIWEWSGSAYDEGDEAAE 137

Query: 550 WFSEFVGKPCRLVRFDSASETRPVDPNYAPGHFAMFSDMYPFLLISQGSLDALNELLMEP 371
           WFS + GKP RLVRF+ ASE R  +P+YA G+  +F+D +PFLL SQGS+DALN +L EP
Sbjct: 138 WFSSYFGKPTRLVRFNEASEIRETNPDYAQGYKVLFADDFPFLLASQGSVDALNSILKEP 197

Query: 370 VPINRFRPNILVDGCELFAEDLWTEILIDNFTFHGVKLCSRCKVPTINQDTGVGGEEPIE 191
           VP+NRFRPNI+VDGC  ++EDLW  I I   TF GVKLC RCKVPTINQD G+ GEEP E
Sbjct: 198 VPMNRFRPNIIVDGCHPYSEDLWKTIKIGKLTFLGVKLCDRCKVPTINQDNGIPGEEPTE 257

Query: 190 TLRSFRSDKFLQPQKKPQGKIYFGQNMVWKDGF-GDGIAKTIEIGDSVLVLGKHSFP 23
            L++ RSD+ L+P  K + ++YFGQN+V K+        + I++GD V VL   SFP
Sbjct: 258 ALQALRSDEVLRPSHKNKRRVYFGQNLVCKESLSAKDEGRIIKVGDPVYVL--ESFP 312

>tr|A9NM27|A9NM27_PICSI Putative uncharacterized protein OS=Picea sitchensis
        PE=2 SV=1

          Length = 324

 Score =  361 bits (925), Expect = 9e-098
 Identities = 177/322 (54%), Positives = 228/322 (70%), Gaps = 3/322 (0%)
 Frame = -1

Query: 967 ERERQRMENALSPSRAGEIAGRVASLYVYPIKSCRGISLSQASLTPTGFRWDRNWLIVNS 788
           ER    + +    + A + A +V ++Y+YPIK+CRGISL Q  + PTGFRWDR WL+VNS
Sbjct:   2 ERIGSLISSVFGNAEAEKPAAKVKAIYIYPIKACRGISLPQVCVCPTGFRWDRQWLVVNS 61

Query: 787 KGRGLTQRVEPKLSLIEVEMPKHAFAQDWQPDNNSNMLVRAPGMDVLKVSLAKPEK-TAD 611
           K R  TQR EPKL+L+EV +P  AF+++W+P  +S + V+APGMD LKV L +  +   +
Sbjct:  62 KCRAYTQRPEPKLALVEVSLPMEAFSEEWEPTADSFLTVKAPGMDPLKVPLLQQNREKVE 121

Query: 610 GVSVWEWFGSALDEGEEASNWFSEFVGKPCRLVRFDSASETRPVDPNYAPGHFAMFSDMY 431
            VS+WEW GSALDEG +A++WFS ++GKPC LVRFD+ASE RP    YA G   MFSD Y
Sbjct: 122 NVSMWEWSGSALDEGADAADWFSRYLGKPCWLVRFDTASEVRPTPAEYARGFKTMFSDEY 181

Query: 430 PFLLISQGSLDALNELLMEPVPINRFRPNILVDGCELFAEDLWTEILIDNFTFHGVKLCS 251
           PFL+ISQ SLD LN+ L EP+PINRFR NI V+ CE FAEDLW  + I+  TFHGVKLC+
Sbjct: 182 PFLVISQESLDTLNKQLKEPLPINRFRTNIFVENCEPFAEDLWKTLRINGLTFHGVKLCA 241

Query: 250 RCKVPTINQDTGVGGEEPIETLRSFRSDKFLQPQKKPQGKIYFGQNMVWKDGFGDGI--A 77
           RCKVPT+NQ+TG+ G EP ETL  FRS   L   KK +G+++FGQN++ ++     +  A
Sbjct: 242 RCKVPTVNQETGIPGNEPAETLSKFRSGDILFSGKKKRGEVFFGQNLICEESLNPKVCKA 301

Query:  76 KTIEIGDSVLVLGKHSFPIEAA 11
           KTI +GDSV VL   S   EAA
Sbjct: 302 KTINVGDSVYVLKMASSWEEAA 323

>tr|Q3E8H2|Q3E8H2_ARATH Putative uncharacterized protein At5g44720.2
        OS=Arabidopsis thaliana GN=At5g44720 PE=4 SV=1

          Length = 230

 Score =  306 bits (783), Expect = 3e-081
 Identities = 140/225 (62%), Positives = 175/225 (77%)
 Frame = -1

Query: 904 RVASLYVYPIKSCRGISLSQASLTPTGFRWDRNWLIVNSKGRGLTQRVEPKLSLIEVEMP 725
           ++ SL +YPIKSCRGIS+ QA++T TGF+WDR WL+VN KGR  TQRVEP L+L+E E+P
Sbjct:   6 KIQSLVIYPIKSCRGISVPQATVTHTGFQWDRYWLVVNYKGRAYTQRVEPTLALVESELP 65

Query: 724 KHAFAQDWQPDNNSNMLVRAPGMDVLKVSLAKPEKTADGVSVWEWFGSALDEGEEASNWF 545
           K AF +DW+P N+S +++RAPGM  LK+ L +P   A+GVS+WEW GSA DEGEEA+ WF
Sbjct:  66 KEAFLEDWEPTNDSLLVIRAPGMSPLKIPLTRPSSVAEGVSMWEWSGSAFDEGEEAAKWF 125

Query: 544 SEFVGKPCRLVRFDSASETRPVDPNYAPGHFAMFSDMYPFLLISQGSLDALNELLMEPVP 365
           S+++GK  RLVRF+  +ETRP  P +A G+   F DM+PFL+ SQGSLD LN LL EPVP
Sbjct: 126 SDYLGKQSRLVRFNKDTETRPSPPEFAAGYSTTFMDMFPFLVASQGSLDHLNTLLPEPVP 185

Query: 364 INRFRPNILVDGCELFAEDLWTEILIDNFTFHGVKLCSRCKVPTI 230
           INRFRPNILVD C+ F EDLW EI I++  F GV+LCSRCKV  I
Sbjct: 186 INRFRPNILVDNCDPFGEDLWDEIKINDLVFQGVRLCSRCKVMII 230

>tr|B8BEF5|B8BEF5_ORYSI Putative uncharacterized protein OS=Oryza sativa subsp.
        indica GN=OsI_32388 PE=4 SV=1

          Length = 307

 Score =  260 bits (662), Expect = 3e-067
 Identities = 125/219 (57%), Positives = 158/219 (72%), Gaps = 3/219 (1%)
 Frame = -1

Query: 676 LVRAPGMDVLKVSLAKPEKTADGVSVWEWFGSALDEGEEASNWFSEFVGKPCRLVRFDSA 497
           ++RAPG+D LK+ L     T D VSVWEW GSA DEG+EA+ WFS   GKP RLVRF+ A
Sbjct:  84 VIRAPGLDPLKIPLGAKRATVDDVSVWEWSGSAYDEGDEAAEWFSSCFGKPTRLVRFNEA 143

Query: 496 SETRPVDPNYAPGHFAMFSDMYPFLLISQGSLDALNELLMEPVPINRFRPNILVDGCELF 317
           SE R  +P+YA G+  +F+D +PFLL SQGS+DALN +L EPVP+NRFRPNI+V+GC  +
Sbjct: 144 SEIRETNPDYAQGYKVLFADAFPFLLASQGSVDALNSILKEPVPMNRFRPNIIVEGCHPY 203

Query: 316 AEDLWTEILIDNFTFHGVKLCSRCKVPTINQDTGVGGEEPIETLRSFRSDKFLQPQKKPQ 137
           +EDLW  I ID  TF GVKLC RCKVPTINQD G+ GEEP E L++ RSD+ L+P  K +
Sbjct: 204 SEDLWKTIKIDKLTFLGVKLCDRCKVPTINQDNGIPGEEPTEALQALRSDEVLRPSHKNK 263

Query: 136 GKIYFGQNMVWKDGF-GDGIAKTIEIGDSVLVLGKHSFP 23
            ++YFGQN+V K+        + I++GD V VL   SFP
Sbjct: 264 RRVYFGQNLVCKESLSAKDEGRIIKVGDPVYVL--ESFP 300

>tr|C0P5S5|C0P5S5_MAIZE Putative uncharacterized protein OS=Zea mays PE=2 SV=1

          Length = 199

 Score =  219 bits (556), Expect = 6e-055
 Identities = 103/171 (60%), Positives = 129/171 (75%)
 Frame = -1

Query: 922 AGEIAGRVASLYVYPIKSCRGISLSQASLTPTGFRWDRNWLIVNSKGRGLTQRVEPKLSL 743
           +G  A  V S+ VYPIKSCRGIS+ QA +T TGFRWDR W++VNSKGR  TQRVEPKL+L
Sbjct:  18 SGAQAATVKSVLVYPIKSCRGISVPQAPITATGFRWDRQWMLVNSKGRACTQRVEPKLAL 77

Query: 742 IEVEMPKHAFAQDWQPDNNSNMLVRAPGMDVLKVSLAKPEKTADGVSVWEWFGSALDEGE 563
           +EV+MP  AFA+DW P  + +M++RAPGM+ LKV L+    T   VSVWEW G+A DEG 
Sbjct:  78 VEVQMPPEAFAEDWHPTPDDHMVIRAPGMEPLKVPLSVECATISDVSVWEWTGAAYDEGA 137

Query: 562 EASNWFSEFVGKPCRLVRFDSASETRPVDPNYAPGHFAMFSDMYPFLLISQ 410
           EA+ WFS F+G P RLVRF+  SETR  DP+YA G+  MFSD +P+L++SQ
Sbjct: 138 EAAEWFSTFLGCPTRLVRFNEDSETRLTDPDYARGYKTMFSDGFPYLIVSQ 188

>tr|D2QLE2|D2QLE2_SPILD MOSC domain containing protein OS=Spirosoma linguale
        (strain ATCC 33905 / DSM 74 / LMG 10896) GN=Slin_3078 PE=4 SV=1

          Length = 287

 Score =  182 bits (460), Expect = 8e-044
 Identities = 116/297 (39%), Positives = 167/297 (56%), Gaps = 37/297 (12%)
 Frame = -1

Query: 898 ASLYVYPIKSCRGISLSQASLTPTGFRWDRNWLIVNSKGRGLTQRVEPKLSLIEVEMPKH 719
           + LY+YPIKS  GISL++A +   GFR+DR +++V   G  +TQR   +++L++V +   
Sbjct:   4 SELYIYPIKSLGGISLTEAIVEEKGFRYDRRFMLVEPDGTFMTQRANHQMALLDVAIQGD 63

Query: 718 AFAQDW---QPDNNSNMLVRAPGMDVLKVSLAKPE----KTADGVSVWEWFGS---ALDE 569
              + W   +PD            DVL++ L  PE     + D ++V  W  +   AL  
Sbjct:  64 TL-RVWHRHRPD------------DVLQLPLVMPEVEPGVSRDWLNVTIWDDNDVPALTV 110

Query: 568 GEEASNWFSEFVGKPCRLVRFDSASETRPVDPNYAPGHFAM-FSDMYPFLLISQGSLDAL 392
            +EA  WFS  +GKPCRLV F   +  RPVDP YA    A+ F+D YP+LLI Q SLD L
Sbjct: 111 SDEADQWFSGVLGKPCRLV-FMPETTHRPVDPAYARQQDAVSFADGYPYLLIGQASLDTL 169

Query: 391 NELLMEPVPINRFRPNILVDGCELFAEDLWTEILIDNFTFHGVKLCSRCKVPTINQDTGV 212
           N+ L +PV + RFRPNI+V G   + ED W+   I   +F+GVK C+RC + TI+ +TG 
Sbjct: 170 NQRLADPVTMQRFRPNIVVSGSLPYEEDAWSHFCIGEISFYGVKPCARCVLTTIDPETGH 229

Query: 211 GGEEPIETLRSFRSDKFLQPQKKPQGKIYFGQNMVWKDGFGDGIAKTIEIGDSVLVL 41
            G EP+ TL ++R  K          KI FGQN++ K     G   ++ +G  + VL
Sbjct: 230 TGREPLRTLSTYRQWKH---------KILFGQNLLVK---LTGEPVSVRVGQQIEVL 274

  Database: UniProt/TrEMBL
    Posted date:  Sat Aug 07 14:51:12 2010
  Number of letters in database: 3,661,877,547
  Number of sequences in database:  11,397,958

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 29,702,651,028
Number of Sequences: 11397958
Number of Extensions: 29702651028
Number of Successful Extensions: 26373191
Number of sequences better than 0.0: 0