Library    |     Search    |     Batch query    |     SNP    |     SSR  

TAIR blast output of UN05621


BLASTX 7.6.2

Query= UN05621 /QuerySize=1211
        (1210 letters)

Database: TAIR9 protein;
          33,410 sequences; 13,468,323 total letters
                                                                  Score    E
Sequences producing significant alignments:                       (bits) Value

TAIR9_protein||AT4G34950.1 | Symbols:  | nodulin family protein ...    452   2e-127
TAIR9_protein||AT2G16660.1 | Symbols:  | nodulin family protein ...    422   3e-118
TAIR9_protein||AT1G74780.1 | Symbols:  | nodulin family protein ...    191   7e-049
TAIR9_protein||AT3G01930.1 | Symbols:  | nodulin family protein ...    190   2e-048
TAIR9_protein||AT3G01930.2 | Symbols:  | nodulin family protein ...    190   2e-048
TAIR9_protein||AT5G14120.1 | Symbols:  | nodulin family protein ...    186   2e-047
TAIR9_protein||AT1G80530.1 | Symbols:  | nodulin family protein ...    184   9e-047
TAIR9_protein||AT1G18940.1 | Symbols:  | nodulin family protein ...    184   1e-046
TAIR9_protein||AT5G50630.1 | Symbols:  | nodulin family protein ...    181   1e-045
TAIR9_protein||AT5G50520.1 | Symbols:  | nodulin family protein ...    181   1e-045
TAIR9_protein||AT2G34350.1 | Symbols:  | nodulin-related | chr2:...    178   8e-045
TAIR9_protein||AT2G34355.1 | Symbols:  | nodulin-related | chr2:...    177   2e-044
TAIR9_protein||AT2G28120.1 | Symbols:  | nodulin family protein ...    163   3e-040
TAIR9_protein||AT2G39210.1 | Symbols:  | nodulin family protein ...    163   4e-040
TAIR9_protein||AT2G30300.1 | Symbols:  | nodulin-related | chr2:...    121   1e-027
TAIR9_protein||AT4G19450.1 | Symbols:  | nodulin-related | chr4:...    117   2e-026

>TAIR9_protein||AT4G34950.1 | Symbols:  | nodulin family protein |
        chr4:16642544-16644759 REVERSE

          Length = 568

 Score =  452 bits (1162), Expect = 2e-127
 Identities = 227/263 (86%), Positives = 240/263 (91%), Gaps = 4/263 (1%)
 Frame = +3

Query: 180 NELPPS-PILRKEEEKNHGGV---EKKRPVLGEDHTILEAALTVDFWVLFVSFLCGVGTG 347
           NELPPS   L  EEE+NHG +   EKKRPVLGE+HTI+EA LTVDFWVLFVSFLCGVGTG
Sbjct: 306 NELPPSLKPLSNEEEENHGTIVTTEKKRPVLGEEHTIMEAMLTVDFWVLFVSFLCGVGTG 365

Query: 348 LAVMNNMGQIGLALGYTDVSIFVSMMSIWGFFGRILSGTISEHFIKKNGTPRPLWNAASQ 527
           LAVMNNMGQIGLALGYTDVSIFVSM SIWGFFGRILSGTISEHFIKK GTPRPLWNAA+Q
Sbjct: 366 LAVMNNMGQIGLALGYTDVSIFVSMTSIWGFFGRILSGTISEHFIKKAGTPRPLWNAAAQ 425

Query: 528 IVMAVGYLLMALAMPGSLYFGSIVVGACYGVRLAITVPIASELFGLKYYGLLYNILILNF 707
           I+MAVGYLLMALA+PGSLY GS+VVG CYGVRLAITVP ASELFGLKYYGL+YNILILN 
Sbjct: 426 IIMAVGYLLMALALPGSLYIGSMVVGVCYGVRLAITVPTASELFGLKYYGLIYNILILNM 485

Query: 708 PLGSFLFSGLLAGLLYDAEATPTPDGGNTCVGAHCYRLVFIVMAFTSIIGVGLDLWLAFR 887
           PLGSFLFSGLLAGLLYDAEATPTP GGNTCVGAHC+R+VFIVMAF SIIGVGLDL LA+R
Sbjct: 486 PLGSFLFSGLLAGLLYDAEATPTPGGGNTCVGAHCFRIVFIVMAFASIIGVGLDLLLAYR 545

Query: 888 TKEIYAKIHASKKVEKSSGNLR* 956
           TK IYAKIHASKK +KS GNLR*
Sbjct: 546 TKGIYAKIHASKKTKKSGGNLR* 568


 Score =  83 bits (203), Expect = 4e-016
 Identities = 41/49 (83%), Positives = 43/49 (87%)
 Frame = +1

Query:  52 GLGRSSSSSSALKWLGFVTAVWVQSISGNNYTFSNYSDALKSLMSCRRL 198
           G   SSSSSSALKWLGFVTAVWVQSISGNNYTFSNYS ALKSLM+  +L
Sbjct:   4 GTSSSSSSSSALKWLGFVTAVWVQSISGNNYTFSNYSGALKSLMNLTQL 52

>TAIR9_protein||AT2G16660.1 | Symbols:  | nodulin family protein |
        chr2:7218930-7221592 REVERSE

          Length = 547

 Score =  422 bits (1083), Expect = 3e-118
 Identities = 207/250 (82%), Positives = 228/250 (91%), Gaps = 5/250 (2%)
 Frame = +3

Query: 201 ILRKEEEKNHGGVEKKRPVLGEDHTILEAALTVDFWVLFVSFLCGVGTGLAVMNNMGQIG 380
           +  +EEEK     ++K+PVLGEDHTI+EA LTVDFWVLFVSFLCGVGTGLAVMNNMGQIG
Sbjct: 301 VAAEEEEK-----KRKKPVLGEDHTIMEAVLTVDFWVLFVSFLCGVGTGLAVMNNMGQIG 355

Query: 381 LALGYTDVSIFVSMMSIWGFFGRILSGTISEHFIKKNGTPRPLWNAASQIVMAVGYLLMA 560
           LALGYT+VSIFVSM SIWGFFGRILSGT+SE+F+KK GTPRPLWNAASQI+MAVGY+LMA
Sbjct: 356 LALGYTNVSIFVSMTSIWGFFGRILSGTLSEYFLKKAGTPRPLWNAASQILMAVGYILMA 415

Query: 561 LAMPGSLYFGSIVVGACYGVRLAITVPIASELFGLKYYGLLYNILILNFPLGSFLFSGLL 740
           LA+P SLY GS+VVG CYGVRLAITVP ASELFGLKYYGL+YNIL+LN PLGSFLFSGLL
Sbjct: 416 LAVPNSLYIGSMVVGVCYGVRLAITVPTASELFGLKYYGLIYNILVLNLPLGSFLFSGLL 475

Query: 741 AGLLYDAEATPTPDGGNTCVGAHCYRLVFIVMAFTSIIGVGLDLWLAFRTKEIYAKIHAS 920
           AG LYDAEATPTP GGNTCVGAHCYRL+FIVMA  S+IGVGLDL LA+RTKEIYAKIHAS
Sbjct: 476 AGFLYDAEATPTPGGGNTCVGAHCYRLIFIVMALASVIGVGLDLVLAYRTKEIYAKIHAS 535

Query: 921 KKVEKSSGNL 950
           KK +KS G+L
Sbjct: 536 KKSKKSGGSL 545


 Score =  85 bits (208), Expect = 9e-017
 Identities = 42/50 (84%), Positives = 44/50 (88%)
 Frame = +1

Query:  49 MGLGRSSSSSSALKWLGFVTAVWVQSISGNNYTFSNYSDALKSLMSCRRL 198
           MG  RS SSSSALKWLGFVTAVWVQSISGNNYTFSNYS ALKSLM+  +L
Sbjct:   1 MGFQRSISSSSALKWLGFVTAVWVQSISGNNYTFSNYSGALKSLMNLNQL 50

>TAIR9_protein||AT1G74780.1 | Symbols:  | nodulin family protein |
        chr1:28095916-28097912 FORWARD

          Length = 534

 Score =  191 bits (485), Expect = 7e-049
 Identities = 99/251 (39%), Positives = 155/251 (61%), Gaps = 8/251 (3%)
 Frame = +3

Query: 174 IPNELPP---SPILRKEEEKNHGGVEKKRPVLGEDHTILEAALTVDFWVLFVSFLCGVGT 344
           +P++  P   SP       ++  G  K    L E+  +L+A   + FW+LF++ +CG+G+
Sbjct: 278 VPHDYSPLISSPKATTSGNQSSEGDSKVEAGLSENLNLLQAMKKLSFWLLFLAMICGMGS 337

Query: 345 GLAVMNNMGQIGLALGYTDVSI--FVSMMSIWGFFGRILSGTISEHFIKKNGTPRPLWNA 518
           GL+ +NN+ QIG +L Y+ V I   VS+ SIW F GR  +G  S+  + K G PRPL  A
Sbjct: 338 GLSTINNIRQIGESLRYSSVEINSLVSLWSIWNFLGRFGAGYASDALLHKKGWPRPLLMA 397

Query: 519 ASQIVMAVGYLLMALAMPGSLYFGSIVVGACYGVRLAITVPIASELFGLKYYGLLYNILI 698
           A+   M++G+L++A    G+LY GS++VG CYG + ++   I SELFG+++ G ++N + 
Sbjct: 398 ATLGTMSIGHLIIASGFQGNLYVGSVIVGVCYGSQWSLMPTITSELFGIRHMGTIFNTIS 457

Query: 699 LNFPLGSFLFSGLLAGLLYDAEATPTPDGGNTCVGAHCYRLVFIVMAFTSIIGVGLDLWL 878
           +  P+GS++FS  L G +YD  A+     GNTC G+HC+RL FI+MA  +  G  + + L
Sbjct: 458 VASPIGSYIFSVRLIGYIYDKTAS---GEGNTCYGSHCFRLSFIIMASVAFFGFLVAIVL 514

Query: 879 AFRTKEIYAKI 911
            FRTK +Y +I
Sbjct: 515 FFRTKTLYRQI 525

>TAIR9_protein||AT3G01930.1 | Symbols:  | nodulin family protein |
        chr3:319289-320777 REVERSE

          Length = 472

 Score =  190 bits (482), Expect = 2e-048
 Identities = 100/242 (41%), Positives = 143/242 (59%), Gaps = 10/242 (4%)
 Frame = +3

Query: 231 GGVEKKR---PVLGEDHTILEAALTVDFWVLFVSFLCGVGTGLAVMNNMGQIGLALGYTD 401
           G V  KR   P  GED T+ +A +  DFW++F S L G G+GL V++N+GQ+  +LGY +
Sbjct: 229 GAVRVKRRRGPHRGEDFTLTQALVKADFWLIFFSLLLGSGSGLTVIDNLGQMSQSLGYDN 288

Query: 402 VSIFVSMMSIWGFFGRILSGTISEHFIKKNGTPRPLWNAASQIVMAVGYLLMALAMPGSL 581
             +FVSM+SIW F GRI  G  SE  ++    PRP+  A +Q+VM+VG++  A   PG++
Sbjct: 289 THVFVSMISIWNFLGRIGGGYFSELIVRDYAYPRPVAIAVAQLVMSVGHIFFAYGWPGAM 348

Query: 582 YFGSIVVGACYGVRLAITVPIASELFGLKYYGLLYNILILNFPLGSFLFSGLLAGLLYDA 761
           + G++++G  YG   AI    ASELFGLK +G LYN L L  P GS +FSGL+A  +YD 
Sbjct: 349 HIGTLLIGLGYGAHWAIVPATASELFGLKKFGALYNFLTLANPAGSLVFSGLIASSIYDR 408

Query: 762 EATP-------TPDGGNTCVGAHCYRLVFIVMAFTSIIGVGLDLWLAFRTKEIYAKIHAS 920
           EA          PD    C G+ CY L  ++M+   +I   L + L  RTK +Y  ++  
Sbjct: 409 EAERQAQGSLFNPDDVLRCRGSICYFLTSLIMSGFCLIAAALSMILVQRTKPVYTNLYGK 468

Query: 921 KK 926
            +
Sbjct: 469 TR 470

>TAIR9_protein||AT3G01930.2 | Symbols:  | nodulin family protein |
        chr3:319289-321488 REVERSE

          Length = 585

 Score =  190 bits (482), Expect = 2e-048
 Identities = 100/242 (41%), Positives = 143/242 (59%), Gaps = 10/242 (4%)
 Frame = +3

Query: 231 GGVEKKR---PVLGEDHTILEAALTVDFWVLFVSFLCGVGTGLAVMNNMGQIGLALGYTD 401
           G V  KR   P  GED T+ +A +  DFW++F S L G G+GL V++N+GQ+  +LGY +
Sbjct: 342 GAVRVKRRRGPHRGEDFTLTQALVKADFWLIFFSLLLGSGSGLTVIDNLGQMSQSLGYDN 401

Query: 402 VSIFVSMMSIWGFFGRILSGTISEHFIKKNGTPRPLWNAASQIVMAVGYLLMALAMPGSL 581
             +FVSM+SIW F GRI  G  SE  ++    PRP+  A +Q+VM+VG++  A   PG++
Sbjct: 402 THVFVSMISIWNFLGRIGGGYFSELIVRDYAYPRPVAIAVAQLVMSVGHIFFAYGWPGAM 461

Query: 582 YFGSIVVGACYGVRLAITVPIASELFGLKYYGLLYNILILNFPLGSFLFSGLLAGLLYDA 761
           + G++++G  YG   AI    ASELFGLK +G LYN L L  P GS +FSGL+A  +YD 
Sbjct: 462 HIGTLLIGLGYGAHWAIVPATASELFGLKKFGALYNFLTLANPAGSLVFSGLIASSIYDR 521

Query: 762 EATP-------TPDGGNTCVGAHCYRLVFIVMAFTSIIGVGLDLWLAFRTKEIYAKIHAS 920
           EA          PD    C G+ CY L  ++M+   +I   L + L  RTK +Y  ++  
Sbjct: 522 EAERQAQGSLFNPDDVLRCRGSICYFLTSLIMSGFCLIAAALSMILVQRTKPVYTNLYGK 581

Query: 921 KK 926
            +
Sbjct: 582 TR 583

>TAIR9_protein||AT5G14120.1 | Symbols:  | nodulin family protein |
        chr5:4556308-4558447 FORWARD

          Length = 580

 Score =  186 bits (472), Expect = 2e-047
 Identities = 94/235 (40%), Positives = 140/235 (59%), Gaps = 7/235 (2%)
 Frame = +3

Query: 243 KKRPVLGEDHTILEAALTVDFWVLFVSFLCGVGTGLAVMNNMGQIGLALGYTDVSIFVSM 422
           ++ P  GED T+ +A +  DFW++F S L G G+GL V++N+GQ+  +LGY +  + VSM
Sbjct: 344 RRGPHRGEDFTLTQALVKADFWLIFFSLLLGSGSGLTVIDNLGQMSQSLGYDNTHVLVSM 403

Query: 423 MSIWGFFGRILSGTISEHFIKKNGTPRPLWNAASQIVMAVGYLLMALAMPGSLYFGSIVV 602
           +SIW F GRI  G  SE  ++    PRP+  A +Q++M+VG++  A   PG++Y G++++
Sbjct: 404 ISIWNFLGRIGGGYFSELVVRDYAYPRPVAMAVAQLIMSVGHIFFAYGWPGAMYIGTLLI 463

Query: 603 GACYGVRLAITVPIASELFGLKYYGLLYNILILNFPLGSFLFSGLLAGLLYDAEATP--- 773
           G  YG   AI    ASELFGLK +G LYN L L  P GS +FSG++A  +YD EA     
Sbjct: 464 GLGYGAHWAIVPATASELFGLKKFGALYNFLTLANPAGSLVFSGMIASSIYDREAERQAH 523

Query: 774 ----TPDGGNTCVGAHCYRLVFIVMAFTSIIGVGLDLWLAFRTKEIYAKIHASKK 926
                PD    C G+ C+ L  ++M+   II   L + L  RTK +Y  ++   +
Sbjct: 524 GSVFDPDDALRCNGSICFFLTSLIMSGFCIIACMLSMILVRRTKSVYTHLYGKTR 578

>TAIR9_protein||AT1G80530.1 | Symbols:  | nodulin family protein |
        chr1:30278224-30280247 REVERSE

          Length = 562

 Score =  184 bits (467), Expect = 9e-047
 Identities = 90/231 (38%), Positives = 143/231 (61%), Gaps = 4/231 (1%)
 Frame = +3

Query: 231 GGVEKKR-PVLGEDHTILEAALTVDFWVLFVSFLCGVGTGLAVMNNMGQIGLALGYTDVS 407
           G V+KKR P  GED    +  +  DFW+L+  +  G+G+G+ V NN+ QIG A G  D +
Sbjct: 322 GAVKKKRKPRRGEDFKFGQVFVKADFWLLWFVYFLGMGSGVTVSNNLAQIGFAFGIKDTT 381

Query: 408 IFVSMMSIWGFFGRILSGTISEHFIKKNGTPRPLWNAASQIVMAVGYLLMALAMPGSLYF 587
           I + + S + F GR+ SG ISEHF++    PR LW  A+Q+VM   +LL A+A+  ++Y 
Sbjct: 382 ILLCLFSFFNFIGRLASGAISEHFVRSRTLPRTLWMGAAQLVMVFTFLLFAMAIDHTIYV 441

Query: 588 GSIVVGACYGVRLAITVPIASELFGLKYYGLLYNILILNFPLGSFLFSGLLAGLLYDAEA 767
            + ++G C G +  +++   SELFGL+++G+ +N ++L  PLG+ +FS +LAG +YD EA
Sbjct: 442 ATALIGICMGFQF-LSIATISELFGLRHFGINFNFILLGNPLGATIFSAILAGYIYDKEA 500

Query: 768 TPTPDGGNTCVGAHCYRLVFIVMAFTSIIGVGLDLWLAFRTKEIYAKIHAS 920
                G  TC+G  C+R+ F+V+A    +G  L + L  R + +Y  ++AS
Sbjct: 501 --DKQGKMTCIGPDCFRVTFLVLAGVCGLGTLLSIILTVRIRPVYQALYAS 549

>TAIR9_protein||AT1G18940.1 | Symbols:  | nodulin family protein |
        chr1:6543852-6545592 FORWARD

          Length = 527

 Score =  184 bits (466), Expect = 1e-046
 Identities = 92/223 (41%), Positives = 142/223 (63%), Gaps = 7/223 (3%)
 Frame = +3

Query: 255 VLGEDHT--ILEAALTVDFWVLFVSFLCGVGTGLAVMNNMGQIGLALGYTDVSI--FVSM 422
           +L ED +  +L+A   VDFW+LF++ +CG+G+G++ +NN+ QIG +L YT V I   +++
Sbjct: 299 MLDEDKSLNLLQAMCNVDFWLLFLAMICGMGSGISTINNIRQIGESLRYTSVEINSLLAL 358

Query: 423 MSIWGFFGRILSGTISEHFIKKNGTPRPLWNAASQIVMAVGYLLMALAMPGSLYFGSIVV 602
            +IW F GR   G +S+  + + G PRPL  A +   M +G+L++A    G+LY GSI+V
Sbjct: 359 WNIWNFIGRFGGGYVSDWLLHRKGWPRPLLMATTLGTMTIGHLIIASGFQGNLYPGSIIV 418

Query: 603 GACYGVRLAITVPIASELFGLKYYGLLYNILILNFPLGSFLFSGLLAGLLYDAEATPTPD 782
           G CYG + ++   I SELFG+K+ G +YN + +  P+GS++FS  L G +YD        
Sbjct: 419 GICYGSQWSLMPTITSELFGVKHMGTIYNTISIASPMGSYIFSVRLIGYIYDRTII---G 475

Query: 783 GGNTCVGAHCYRLVFIVMAFTSIIGVGLDLWLAFRTKEIYAKI 911
            GNTC G HC+RL ++V+A  + +G  +   L FRTK IY +I
Sbjct: 476 EGNTCYGPHCFRLAYVVIASVAFLGFLVSCVLVFRTKTIYRQI 518

>TAIR9_protein||AT5G50630.1 | Symbols:  | nodulin family protein |
        chr5:20603021-20604928 REVERSE

          Length = 541

 Score =  181 bits (457), Expect = 1e-045
 Identities = 93/238 (39%), Positives = 148/238 (62%), Gaps = 6/238 (2%)
 Frame = +3

Query: 219 EKNHGGVEKKR-PVLGEDHTILEAALTVDFWVLFVSFLCGVGTGLAVMNNMGQIGLALGY 395
           E++    EKKR P +GED T+L+A    DFW++F+S + GVG+G+ +++N+GQI  +LGY
Sbjct: 297 ERSDRPPEKKRAPCIGEDFTLLQALGQADFWLIFMSLVLGVGSGITIIDNLGQICYSLGY 356

Query: 396 TDVSIFVSMMSIWGFFGRILSGTISEHFIKKNGTPRPLWNAASQIVMAVGYLLMALAMPG 575
           ++  IFVS++SI  F GR+  G  SE  I+K   PR L  +  Q +M++G +  A+  PG
Sbjct: 357 SNTKIFVSLISISNFLGRVAGGYFSELIIRKLSLPRTLAMSVVQAIMSLGLIYYAIDWPG 416

Query: 576 SLYFGSIVVGACYGVRLAITVPIASELFGLKYYGLLYNILILNFPLGSFLFSGLLAGLLY 755
            +Y  +IV+G  YG   AI     S++FGLK +G LYN  I   P+GSF+FSG++A  +Y
Sbjct: 417 KIYVVTIVIGMGYGAHWAIAPASVSDIFGLKSFGSLYNFQITALPIGSFVFSGVIASNIY 476

Query: 756 D----AEATPTPDGGN-TCVGAHCYRLVFIVMAFTSIIGVGLDLWLAFRTKEIYAKIH 914
           D     +A PT +  +  C G+ CY +   +M+   ++ + L L + +RT++ Y ++H
Sbjct: 477 DYYARKQAGPTTETESLVCTGSVCYSVTCSLMSMLCLMAMVLSLSVVYRTRKFYLRLH 534

>TAIR9_protein||AT5G50520.1 | Symbols:  | nodulin family protein |
        chr5:20569680-20571587 REVERSE

          Length = 541

 Score =  181 bits (457), Expect = 1e-045
 Identities = 93/238 (39%), Positives = 148/238 (62%), Gaps = 6/238 (2%)
 Frame = +3

Query: 219 EKNHGGVEKKR-PVLGEDHTILEAALTVDFWVLFVSFLCGVGTGLAVMNNMGQIGLALGY 395
           E++    EKKR P +GED T+L+A    DFW++F+S + GVG+G+ +++N+GQI  +LGY
Sbjct: 297 ERSDRPPEKKRAPCIGEDFTLLQALGQADFWLIFMSLVLGVGSGITIIDNLGQICYSLGY 356

Query: 396 TDVSIFVSMMSIWGFFGRILSGTISEHFIKKNGTPRPLWNAASQIVMAVGYLLMALAMPG 575
           ++  IFVS++SI  F GR+  G  SE  I+K   PR L  +  Q +M++G +  A+  PG
Sbjct: 357 SNTKIFVSLISISNFLGRVAGGYFSELIIRKLSLPRTLAMSVVQAIMSLGLIYYAIDWPG 416

Query: 576 SLYFGSIVVGACYGVRLAITVPIASELFGLKYYGLLYNILILNFPLGSFLFSGLLAGLLY 755
            +Y  +IV+G  YG   AI     S++FGLK +G LYN  I   P+GSF+FSG++A  +Y
Sbjct: 417 KIYVVTIVIGMGYGAHWAIAPASVSDIFGLKSFGSLYNFQITALPIGSFVFSGVIASNIY 476

Query: 756 D----AEATPTPDGGN-TCVGAHCYRLVFIVMAFTSIIGVGLDLWLAFRTKEIYAKIH 914
           D     +A PT +  +  C G+ CY +   +M+   ++ + L L + +RT++ Y ++H
Sbjct: 477 DYYARKQAGPTTETESLVCTGSVCYSVTCSLMSMLCLMAMVLSLSVVYRTRKFYLRLH 534

>TAIR9_protein||AT2G34350.1 | Symbols:  | nodulin-related |
        chr2:14493624-14495644 FORWARD

          Length = 526

 Score =  178 bits (450), Expect = 8e-045
 Identities = 89/227 (39%), Positives = 147/227 (64%), Gaps = 5/227 (2%)
 Frame = +3

Query: 249 RPVLGEDHTILEAALTVDFWVLFVSFLCGVGTGLAVMNNMGQIGLALGYTDVSI--FVSM 422
           + V+  D  +LEA  T +FW+LFV+ +CG+G+GLA +NN+ Q+G +L Y+ V +   VS+
Sbjct: 299 KDVMTNDMNVLEAICTTNFWLLFVAMICGMGSGLATINNIRQMGESLRYSTVQLNSLVSL 358

Query: 423 MSIWGFFGRILSGTISEHFIKKNGTPRPLWNAASQIVMAVGYLLMALAMPGSLYFGSIVV 602
            SIW F GR  SG IS+ ++  +G PRP++ A +  +MA+G+++MA  + GSLY GS++V
Sbjct: 359 WSIWNFLGRFGSGYISDTYLHSHGWPRPVFMAITLGLMAIGHIVMASGLLGSLYIGSLLV 418

Query: 603 GACYGVRLAITVPIASELFGLKYYGLLYNILILNFPLGSFLFSGLLAGLLYDAEATPTPD 782
           G  YG + ++   I SE+FG+ + G ++  + +  P+GS+ FS  + G LYD  A+   +
Sbjct: 419 GLAYGSQWSLMPTITSEIFGVLHMGTIFYTISIASPVGSYFFSVKVIGYLYDKVAS---E 475

Query: 783 GGNTCVGAHCYRLVFIVMAFTSIIGVGLDLWLAFRTKEIYAKIHASK 923
             ++C G HC+R  F++MA  +++G  + L L  RTK+ YA + A +
Sbjct: 476 DDHSCYGNHCFRTSFLIMAAMALLGSLVALVLLLRTKKFYATLVAKR 522

>TAIR9_protein||AT2G34355.1 | Symbols:  | nodulin-related |
        chr2:14496376-14498311 FORWARD

          Length = 524

 Score =  177 bits (447), Expect = 2e-044
 Identities = 87/228 (38%), Positives = 146/228 (64%), Gaps = 5/228 (2%)
 Frame = +3

Query: 255 VLGEDHTILEAALTVDFWVLFVSFLCGVGTGLAVMNNMGQIGLALGYTDVSI--FVSMMS 428
           ++ ED  ILEA  TV+FW+LF++ LCG+G+G A +NNM QIG +L Y+ V +   VS+ S
Sbjct: 299 LVAEDSNILEAMSTVNFWLLFLAMLCGMGSGFATVNNMRQIGESLRYSSVQLNSLVSLWS 358

Query: 429 IWGFFGRILSGTISEHFIKKNGTPRPLWNAASQIVMAVGYLLMALAMPGSLYFGSIVVGA 608
           IW F GR  +G +S+ F+ K+  PRP++ A +  VMA+G++++A  + GSLY GS+++G 
Sbjct: 359 IWNFLGRFGAGYVSDTFLHKHSWPRPIFMAITLGVMAIGHIIVASGVQGSLYAGSVLIGM 418

Query: 609 CYGVRLAITVPIASELFGLKYYGLLYNILILNFPLGSFLFSGLLAGLLYDAEATPTPDGG 788
            YG + ++   I SE+FG+++ G +Y  + +  P+GS++ S  + G  YD  A+   +  
Sbjct: 419 AYGSQWSLMPTITSEIFGIRHMGTIYFTISIAGPIGSYILSVKVIGYFYDKVAS---EDD 475

Query: 789 NTCVGAHCYRLVFIVMAFTSIIGVGLDLWLAFRTKEIYAKIHASKKVE 932
           N+C G+ C+R  F++MA  ++ G  +   L FRT + Y  + A + ++
Sbjct: 476 NSCFGSQCFRTSFMIMASVALFGSLVASVLFFRTHKFYKNLVAKRNLK 523

>TAIR9_protein||AT2G28120.1 | Symbols:  | nodulin family protein |
        chr2:11985934-11987667 FORWARD

          Length = 578

 Score =  163 bits (411), Expect = 3e-040
 Identities = 81/174 (46%), Positives = 117/174 (67%), Gaps = 2/174 (1%)
 Frame = +3

Query: 252 PVLGEDHTILEAALTVDFWVLFVSFLCGVGTGLAVMNNMGQIGLALGYTD--VSIFVSMM 425
           P  GED+TIL+A L+ D  +LFV+  CG+G+ L  ++N+GQIG +LGY +  VS FVS++
Sbjct: 319 PPRGEDYTILQALLSTDMIILFVATFCGLGSSLTAVDNLGQIGESLGYPNHTVSSFVSLV 378

Query: 426 SIWGFFGRILSGTISEHFIKKNGTPRPLWNAASQIVMAVGYLLMALAMPGSLYFGSIVVG 605
           SIW +FGR+ SG +SE+ + K   PRPL      ++   G+LL+A  +PGS+Y  SI++G
Sbjct: 379 SIWNYFGRVFSGFVSEYLLAKYKLPRPLMMTLVLLLSCAGHLLIAFPVPGSVYIASILMG 438

Query: 606 ACYGVRLAITVPIASELFGLKYYGLLYNILILNFPLGSFLFSGLLAGLLYDAEA 767
             +G +L +   I SELFGLKYY  L+N   L  PLGS++ +  + G+LYD EA
Sbjct: 439 FSFGAQLPLLFAIISELFGLKYYSTLFNCGQLASPLGSYILNVRVTGMLYDKEA 492

>TAIR9_protein||AT2G39210.1 | Symbols:  | nodulin family protein |
        chr2:16366287-16368231 REVERSE

          Length = 602

 Score =  163 bits (410), Expect = 4e-040
 Identities = 79/174 (45%), Positives = 116/174 (66%), Gaps = 2/174 (1%)
 Frame = +3

Query: 252 PVLGEDHTILEAALTVDFWVLFVSFLCGVGTGLAVMNNMGQIGLALGY--TDVSIFVSMM 425
           P  G+D+TIL+A  +VD  +LF++ +CGVG  L  ++N+GQIG +LGY    VS FVS++
Sbjct: 328 PERGDDYTILQALFSVDMLILFLATICGVGGTLTAIDNLGQIGNSLGYPKRSVSTFVSLV 387

Query: 426 SIWGFFGRILSGTISEHFIKKNGTPRPLWNAASQIVMAVGYLLMALAMPGSLYFGSIVVG 605
           SIW ++GR++SG +SE F+ K   PRPL      ++   G+LL+A  +PG LY  S+++G
Sbjct: 388 SIWNYYGRVVSGVVSEIFLIKYKFPRPLMLTMVLLLSCAGHLLIAFNVPGGLYVASVIIG 447

Query: 606 ACYGVRLAITVPIASELFGLKYYGLLYNILILNFPLGSFLFSGLLAGLLYDAEA 767
            C+G +  +   I SE+FGLKYY  LYN   +  P+GS+L +  +AG LYD EA
Sbjct: 448 FCFGAQWPLLFAIISEIFGLKYYSTLYNFGSVASPIGSYLLNVRVAGYLYDVEA 501

>TAIR9_protein||AT2G30300.1 | Symbols:  | nodulin-related |
        chr2:12919401-12921222 FORWARD

          Length = 501

 Score =  121 bits (302), Expect = 1e-027
 Identities = 76/245 (31%), Positives = 122/245 (49%), Gaps = 5/245 (2%)
 Frame = +3

Query: 183 ELPPSPILRKEEEKNHGGVEKKRPVLGEDHTILEAAL--TVDFWVLFVSFLCGVGTGLAV 356
           E P       EE+      E ++ ++G    +    L   +DFW+ F  +L G   GL  
Sbjct: 256 EAPVDKFYFVEEDHTKEEEEFEKAIIGVKEEVEWTQLWKKLDFWIYFGLYLFGPTVGLVF 315

Query: 357 MNNMGQIGLALGYTDVSIFVSMMSIWGFFGRILSGTISEHFIKKNGTP-RPLWNAASQIV 533
            NN+GQI  + G T  S  V++ S +GFFGR+L   +   F +    P  P+  A S + 
Sbjct: 316 TNNLGQIAESRGSTATSSLVALSSSFGFFGRLLPSLLDYFFSRNKYMPSSPVSMAGSLVA 375

Query: 534 MAVGYLLMALAMPGSLYFGSIVVGACYGVRLAITVPIASELFGLKYYGLLYNILILNFPL 713
           M   +LL+ +    +LY G+ ++G   G   +++V + +ELFG K++G+ +NI++ + PL
Sbjct: 376 MVASFLLLLIDSDIALYIGTAMIGIFSGALTSLSVTMTAELFGTKHFGVNHNIVVGSIPL 435

Query: 714 GSFLFSGLLAGLLYDAEATPTPDGGNTCVGAHCYRLVFIVMAFTSIIGVGLDLWLAFRTK 893
           GSF F GLLA  +Y   A    D G  C G HC++   +       I   L   L  R +
Sbjct: 436 GSFSF-GLLAAKIYRDGAALYGDDGK-CFGMHCFQTTLVFWGMLCSIAALLAAVLYIRNR 493

Query: 894 EIYAK 908
           + Y++
Sbjct: 494 KFYSQ 498

>TAIR9_protein||AT4G19450.1 | Symbols:  | nodulin-related |
        chr4:10606538-10609218 FORWARD

          Length = 573

 Score =  117 bits (291), Expect = 2e-026
 Identities = 83/268 (30%), Positives = 134/268 (50%), Gaps = 15/268 (5%)
 Frame = +3

Query: 153 QLLRRSQIPNELPPSPILRKEEEKNHGGVEK-----KRPVLGEDHTILEAALTVDFWVLF 317
           QLL    + N  P   +  +EE+ +    +K     +   LG +H++       DFW+ +
Sbjct: 301 QLLSDDVVQN--PVKSVAVEEEDSDESCCKKLITRDQLEGLGIEHSLSLLLTRSDFWLYY 358

Query: 318 VSFLCGVGTGLAVMNNMGQIGLALGY-TDVSIFVSMMSIWGFFGRILSGTISEHFIKKNG 494
           +++ CG   GL   NN+GQI  +LG  ++ +  V++ S + FFGR+LS T  ++   K  
Sbjct: 359 ITYFCGGTIGLVYSNNLGQIAQSLGQSSNTTTLVTLYSAFSFFGRLLSAT-PDYIRAKVY 417

Query: 495 TPRPLWNAASQIVMAVG-YLLMALAMPGSLYFGSIVVGACYGVRLAITVPIASELFGLKY 671
             R  W A + +      +LL +     +L  G+ ++G   G   A  V I SELFG   
Sbjct: 418 FARTGWLAIALLPTPFALFLLASSGTASALQAGTALMGLSSGFIFAAAVSITSELFGPNS 477

Query: 672 YGLLYNILILNFPLGSFLFSGLLAGLLYDAEA-TPTPDGGN---TCVGAHCYRLVFIVMA 839
            G+ +NILI N P+GS ++ G LA L+YD+   T T    +    C+G  CY L F+   
Sbjct: 478 VGVNHNILITNIPIGSLIY-GFLAALVYDSHGFTGTKSMTSESVVCMGRDCYYLTFVWWG 536

Query: 840 FTSIIGVGLDLWLAFRTKEIYAKIHASK 923
             S++G+G  L L  RT+  Y +   ++
Sbjct: 537 CLSLLGLGSSLVLFIRTRRAYQRFEQAR 564

  Database: TAIR9 protein
    Posted date:  Wed Jul 08 15:16:08 2009
  Number of letters in database: 13,468,323
  Number of sequences in database:  33,410

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 3,494,594,153
Number of Sequences: 33410
Number of Extensions: 3494594153
Number of Successful Extensions: 126829027
Number of sequences better than 0.0: 0