Library    |     Search    |     Batch query    |     SNP    |     SSR  

TAIR blast output of UN06271


BLASTX 7.6.2

Query= UN06271 /QuerySize=583
        (582 letters)

Database: TAIR9 protein;
          33,410 sequences; 13,468,323 total letters
                                                                  Score    E
Sequences producing significant alignments:                       (bits) Value

TAIR9_protein||AT4G10810.1 | Symbols:  | unknown protein | chr4:...    135   2e-032
TAIR9_protein||AT4G24026.1 | Symbols:  | unknown protein | chr4:...    110   7e-025
TAIR9_protein||AT4G24030.1 | Symbols:  | unknown protein | chr4:...     90   8e-019

>TAIR9_protein||AT4G10810.1 | Symbols:  | unknown protein | chr4:6645986-6646231
        REVERSE

          Length = 82

 Score =  135 bits (339), Expect = 2e-032
 Identities = 72/85 (84%), Positives = 76/85 (89%), Gaps = 6/85 (7%)
 Frame = +2

Query: 122 MDNSSSIN---STASNLSTSSLEKLDQAASWVSTTVISAFFASLERCACVNLSTSDDDDD 292
           MDNSSSIN   STASNLST+SLEKLDQAASWVSTTVISAFFASLERC+CVNLSTSDDDD+
Sbjct:   1 MDNSSSINSTASTASNLSTASLEKLDQAASWVSTTVISAFFASLERCSCVNLSTSDDDDE 60

Query: 293 DDYNEESHNRPLALSAAPQPEDIV* 367
               EESHNRPLALSAAP P+DIV*
Sbjct:  61 ---GEESHNRPLALSAAPHPDDIV* 82

>TAIR9_protein||AT4G24026.1 | Symbols:  | unknown protein |
        chr4:12486415-12486651 FORWARD

          Length = 79

 Score =  110 bits (274), Expect = 7e-025
 Identities = 54/77 (70%), Positives = 65/77 (84%), Gaps = 1/77 (1%)
 Frame = +2

Query: 137 SINSTASNLSTSSLEKLDQAASWVSTTVISAFFASLERCACVNLSTSDDDDDDDYNEESH 316
           SI+ T++  +T+S+EK+D AASW+S TVISAFF SLERCACVNLSTS DDDDDD ++ESH
Sbjct:   4 SISITSNVSTTTSMEKIDHAASWISATVISAFFTSLERCACVNLSTSHDDDDDD-DDESH 62

Query: 317 NRPLALSAAPQPEDIV* 367
           +RPLALSAAP P D V*
Sbjct:  63 HRPLALSAAPHPNDTV* 79

>TAIR9_protein||AT4G24030.1 | Symbols:  | unknown protein |
        chr4:12486247-12486633 REVERSE

          Length = 129

 Score =  90 bits (222), Expect = 8e-019
 Identities = 51/81 (62%), Positives = 60/81 (74%), Gaps = 5/81 (6%)
 Frame = -3

Query: 343 SGGESKGTIVGFLVVVVVVVIIGGG*IDAGATLEGGEEGGYDGCADPARSLI*LLEG-RR 167
           SGGES+ T++GF VVVVVVV++ GG IDAGA  EGGEE GY GCADPA  ++ L  G RR
Sbjct:   3 SGGESERTVMGF-VVVVVVVVMRGGEIDAGAAFEGGEESGYYGCADPASGVVDLFHGSRR 61

Query: 166 AQVGGGGIDAAAVIHGFLIQL 104
           A VGG   DA A +HGF I+L
Sbjct:  62 ANVGG---DADAFVHGFWIRL 79

  Database: TAIR9 protein
    Posted date:  Wed Jul 08 15:16:08 2009
  Number of letters in database: 13,468,323
  Number of sequences in database:  33,410

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 3,865,654,250
Number of Sequences: 33410
Number of Extensions: 3865654250
Number of Successful Extensions: 147658413
Number of sequences better than 0.0: 0