Library    |     Search    |     Batch query    |     SNP    |     SSR  

TrEMBL blast output of UN10144


BLASTX 7.6.2

Query= UN10144 /QuerySize=1005
        (1004 letters)

Database: UniProt/TrEMBL;
          11,397,958 sequences; 3,661,877,547 total letters
                                                                  Score    E
Sequences producing significant alignments:                       (bits) Value

tr|B9DHN0|B9DHN0_ARATH AT5G63880 protein (Fragment) OS=Arabidops...    237   2e-060
tr|B9HEZ5|B9HEZ5_POPTR Predicted protein OS=Populus trichocarpa ...    218   7e-055
tr|B9H4L4|B9H4L4_POPTR Predicted protein OS=Populus trichocarpa ...    218   1e-054
tr|C6TE32|C6TE32_SOYBN Putative uncharacterized protein OS=Glyci...    200   4e-049
tr|C6TEQ1|C6TEQ1_SOYBN Putative uncharacterized protein OS=Glyci...    198   1e-048
tr|C5XX36|C5XX36_SORBI Putative uncharacterized protein Sb04g024...    196   3e-048
tr|C6T3K6|C6T3K6_SOYBN Putative uncharacterized protein (Fragmen...    196   4e-048
tr|A5BGJ1|A5BGJ1_VITVI Putative uncharacterized protein OS=Vitis...    193   3e-047
tr|B4FJ73|B4FJ73_MAIZE Putative uncharacterized protein OS=Zea m...    178   1e-042
tr|B8AER9|B8AER9_ORYSI Putative uncharacterized protein OS=Oryza...    178   1e-042
tr|B4FQH1|B4FQH1_MAIZE Putative uncharacterized protein OS=Zea m...    178   1e-042
tr|B6TFV6|B6TFV6_MAIZE Charged multivesicular body protein 6 OS=...    178   1e-042
tr|C0PNJ6|C0PNJ6_MAIZE Putative uncharacterized protein OS=Zea m...    178   1e-042
tr|Q6K912|Q6K912_ORYSJ Os02g0596500 protein OS=Oryza sativa subs...    177   2e-042
tr|B8LM95|B8LM95_PICSI Putative uncharacterized protein OS=Picea...    172   8e-041
tr|B9T5A6|B9T5A6_RICCO Charged multivesicular body protein, puta...    163   5e-038
tr|A9U1V3|A9U1V3_PHYPA Predicted protein OS=Physcomitrella paten...    161   1e-037
tr|B9NDG3|B9NDG3_POPTR Predicted protein (Fragment) OS=Populus t...    114   3e-023

>tr|B9DHN0|B9DHN0_ARATH AT5G63880 protein (Fragment) OS=Arabidopsis thaliana
        GN=AT5G63880 PE=2 SV=1

          Length = 143

 Score =  237 bits (604), Expect = 2e-060
 Identities = 124/143 (86%), Positives = 132/143 (92%), Gaps = 1/143 (0%)
 Frame = +1

Query: 424 QWVINVEQQLADIELTSKQKAVFESLKQGSSAIKAIQSEVDLDDVQKLMDDTADAKAYQD 603
           QWVINVEQQL DIELTSKQKAVFESLKQG+SAIKAIQSE+DLDDVQKLMDDTADAKAYQD
Sbjct:   1 QWVINVEQQLTDIELTSKQKAVFESLKQGNSAIKAIQSELDLDDVQKLMDDTADAKAYQD 60

Query: 604 ELNAILGEKLSAEDEEEILAEFDNLESQLAVDEMPDVPTTEPQESEKIDLPDVPTRNP-S 780
           ELNAILGEKLSAEDEE+ILAEFDNLESQL VDEMP+VPT E +ESEK+DLPDVPT+ P +
Sbjct:  61 ELNAILGEKLSAEDEEDILAEFDNLESQLIVDEMPEVPTKESEESEKLDLPDVPTKTPVA 120

Query: 781 LPC*ITPAESATKRKVLEEPLPA 849
               ITPAESATK KVLEEPLPA
Sbjct: 121 SNAEITPAESATKTKVLEEPLPA 143

>tr|B9HEZ5|B9HEZ5_POPTR Predicted protein OS=Populus trichocarpa
        GN=POPTRDRAFT_802672 PE=4 SV=1

          Length = 222

 Score =  218 bits (555), Expect = 7e-055
 Identities = 117/178 (65%), Positives = 143/178 (80%), Gaps = 4/178 (2%)
 Frame = +1

Query: 328 SCKRLNPRK*KGEGFVSTEEETDAKDLLKQVDQWVINVEQQLADIELTSKQKAVFESLKQ 507
           + K L   K K    ++ +++   ++LLKQVD W+INVEQQLADIEL SKQKAVFESLK 
Sbjct:  45 AAKDLIREKRKDRALLALKKKKTQEELLKQVDTWLINVEQQLADIELASKQKAVFESLKS 104

Query: 508 GSSAIKAIQSEVDLDDVQKLMDDTADAKAYQDELNAILGEKLSAEDEEEILAEFDNLESQ 687
           G+ AIKAIQSEV+LDDVQKLMDDTA+AKAYQDE+NAILGEKLSAEDEEEILAEF++LE+Q
Sbjct: 105 GTDAIKAIQSEVNLDDVQKLMDDTAEAKAYQDEINAILGEKLSAEDEEEILAEFEDLETQ 164

Query: 688 LAVDEMPDVPT--TEPQESEKIDLPDVPTRNPSL--PC*ITPAESATKRKVLEEPLPA 849
           +AV ++P+VPT     ++ +K+DLPDVPT+ P L     I+ AE  TKRKVLEEPLPA
Sbjct: 165 VAVQDLPEVPTIVVSEEQEQKLDLPDVPTKPPVLVDDAEISSAEVPTKRKVLEEPLPA 222


 Score =  114 bits (283), Expect = 3e-023
 Identities = 57/69 (82%), Positives = 64/69 (92%)
 Frame = +2

Query: 197 MGNMFVKKPQITDVDRAILSLKTQRRKLGQYQQQLEKVIEAEKQAARDLIRENRKERVLL 376
           MGN+FVKKP+ITDVDRAILSLKTQRRKL QYQQQLE VIEAEK AA+DLIRE RK+R LL
Sbjct:   1 MGNLFVKKPKITDVDRAILSLKTQRRKLAQYQQQLETVIEAEKLAAKDLIREKRKDRALL 60

Query: 377 ALRKKRTQK 403
           AL+KK+TQ+
Sbjct:  61 ALKKKKTQE 69

>tr|B9H4L4|B9H4L4_POPTR Predicted protein OS=Populus trichocarpa
        GN=POPTRDRAFT_558455 PE=4 SV=1

          Length = 222

 Score =  218 bits (553), Expect = 1e-054
 Identities = 117/178 (65%), Positives = 141/178 (79%), Gaps = 4/178 (2%)
 Frame = +1

Query: 328 SCKRLNPRK*KGEGFVSTEEETDAKDLLKQVDQWVINVEQQLADIELTSKQKAVFESLKQ 507
           + K L   K K    ++ +++   ++LLKQVD W+INVEQQLADIEL SKQKAVFESLK 
Sbjct:  45 AAKDLIREKRKDRALLALKKKKTQEELLKQVDTWLINVEQQLADIELASKQKAVFESLKS 104

Query: 508 GSSAIKAIQSEVDLDDVQKLMDDTADAKAYQDELNAILGEKLSAEDEEEILAEFDNLESQ 687
           G+ AIKAIQSEV+LDDVQKLMDDTA+AKAYQDE+NAILGEKLSAEDEEEILAEF+NLE+Q
Sbjct: 105 GTDAIKAIQSEVNLDDVQKLMDDTAEAKAYQDEINAILGEKLSAEDEEEILAEFENLEAQ 164

Query: 688 LAVDEMPDVPT--TEPQESEKIDLPDVPTRNPSL--PC*ITPAESATKRKVLEEPLPA 849
           +AV E P+VPT     ++ +K+DLPDVPT+ P L        AE +T+RKVLEEPLPA
Sbjct: 165 MAVQEWPEVPTKVLSEEQEQKLDLPDVPTKPPVLVDDAETASAEVSTRRKVLEEPLPA 222


 Score =  116 bits (289), Expect = 5e-024
 Identities = 58/69 (84%), Positives = 65/69 (94%)
 Frame = +2

Query: 197 MGNMFVKKPQITDVDRAILSLKTQRRKLGQYQQQLEKVIEAEKQAARDLIRENRKERVLL 376
           MGN+FVKKP+ITDVDRAILSLKTQRRKL QYQQQLE VIEAEKQAA+DLIRE RK+R LL
Sbjct:   1 MGNIFVKKPKITDVDRAILSLKTQRRKLAQYQQQLEAVIEAEKQAAKDLIREKRKDRALL 60

Query: 377 ALRKKRTQK 403
           AL+KK+TQ+
Sbjct:  61 ALKKKKTQE 69

>tr|C6TE32|C6TE32_SOYBN Putative uncharacterized protein OS=Glycine max PE=2
        SV=1

          Length = 215

 Score =  200 bits (506), Expect = 4e-049
 Identities = 104/164 (63%), Positives = 132/164 (80%), Gaps = 5/164 (3%)
 Frame = +1

Query: 352 K*KGEGFVSTEEETDAKDLLKQVDQWVINVEQQLADIELTSKQKAVFESLKQGSSAIKAI 531
           K K    ++ +++   ++LLKQVD W+INVEQQLADIEL SKQKAVFESLK G+ A+KAI
Sbjct:  53 KKKDRALLALKKKKTQEELLKQVDAWLINVEQQLADIELASKQKAVFESLKAGNDAMKAI 112

Query: 532 QSEVDLDDVQKLMDDTADAKAYQDELNAILGEKLSAEDEEEILAEFDNLESQLAVDEMPD 711
           QSE++++DVQKLMDDTA+AKAYQDE+N I+GEKLSAEDEEEILAEF++LE QL V ++P+
Sbjct: 113 QSEINIEDVQKLMDDTAEAKAYQDEINEIMGEKLSAEDEEEILAEFEDLEIQLTVQDLPE 172

Query: 712 VPTTEPQE-SEKIDLPDVPTRNPSLPC*ITPAESATKRKVLEEP 840
           VP +  +E  EK+DLPDVPT+ P      + AE  TKRKV+EEP
Sbjct: 173 VPPSANEEIEEKLDLPDVPTKAPV----TSDAEVFTKRKVMEEP 212

>tr|C6TEQ1|C6TEQ1_SOYBN Putative uncharacterized protein OS=Glycine max PE=2
        SV=1

          Length = 215

 Score =  198 bits (502), Expect = 1e-048
 Identities = 103/164 (62%), Positives = 132/164 (80%), Gaps = 5/164 (3%)
 Frame = +1

Query: 352 K*KGEGFVSTEEETDAKDLLKQVDQWVINVEQQLADIELTSKQKAVFESLKQGSSAIKAI 531
           K K    ++ +++   ++LLKQVD W+INVEQQLADIEL SKQKAVFESLK G+ A+KAI
Sbjct:  53 KKKDRALLALKKKKTQEELLKQVDAWLINVEQQLADIELASKQKAVFESLKAGNDAMKAI 112

Query: 532 QSEVDLDDVQKLMDDTADAKAYQDELNAILGEKLSAEDEEEILAEFDNLESQLAVDEMPD 711
           QSE++++DVQKLMDDTA+AKAYQDE+N I+GEKLSAEDEEEILAEF++LE QL V ++P+
Sbjct: 113 QSEINIEDVQKLMDDTAEAKAYQDEINEIMGEKLSAEDEEEILAEFEDLEIQLTVQDLPE 172

Query: 712 VPTTEPQE-SEKIDLPDVPTRNPSLPC*ITPAESATKRKVLEEP 840
           VP +  +E  EK+ LPDVPT+ P      + AE +TKRKV+EEP
Sbjct: 173 VPPSANEEIEEKLGLPDVPTKAPV----TSDAEVSTKRKVMEEP 212

>tr|C5XX36|C5XX36_SORBI Putative uncharacterized protein Sb04g024940 OS=Sorghum
        bicolor GN=Sb04g024940 PE=4 SV=1

          Length = 224

 Score =  196 bits (498), Expect = 3e-048
 Identities = 102/186 (54%), Positives = 137/186 (73%), Gaps = 18/186 (9%)
 Frame = +1

Query: 328 SCKRLNPRK*KGEGFVSTEEETDAKDLLKQVDQWVINVEQQLADIELTSKQKAVFESLKQ 507
           + ++L  +K +    ++ +++   ++LLKQVD W +NVEQQLADIEL SKQKAVFESLK 
Sbjct:  45 AARQLVQQKKRDRALIALKKKKAQEELLKQVDTWQMNVEQQLADIELASKQKAVFESLKA 104

Query: 508 GSSAIKAIQSEVDLDDVQKLMDDTADAKAYQDELNAILGEKLSAEDEEEILAEFDNLESQ 687
           G++A+K+IQ+E+++DDVQKLMDDTA+AKAYQDE+NA+LGE+LSAEDEE ++AEF+NLE+Q
Sbjct: 105 GNAALKSIQNEINIDDVQKLMDDTAEAKAYQDEINAVLGEQLSAEDEEAVMAEFENLEAQ 164

Query: 688 LAVDEMPDVPTTEPQE------------SEKIDLPDVPTRNPSLPC*ITPAESATKRKVL 831
           LA + +PD P TE +              E I+LPDVPT+ P  P      E+  K KVL
Sbjct: 165 LAAESLPDAPVTEVRPVPANTEAASEDIDEVIELPDVPTKVPERP------EAPEKTKVL 218

Query: 832 EEPLPA 849
           EEPLPA
Sbjct: 219 EEPLPA 224

>tr|C6T3K6|C6T3K6_SOYBN Putative uncharacterized protein (Fragment) OS=Glycine
        max PE=2 SV=1

          Length = 214

 Score =  196 bits (497), Expect = 4e-048
 Identities = 102/162 (62%), Positives = 131/162 (80%), Gaps = 5/162 (3%)
 Frame = +1

Query: 352 K*KGEGFVSTEEETDAKDLLKQVDQWVINVEQQLADIELTSKQKAVFESLKQGSSAIKAI 531
           K K    ++ +++   ++LLKQVD W+INVEQQLADIEL SKQKAVFESLK G+ A+KAI
Sbjct:  53 KKKDRALLALKKKKTQEELLKQVDAWLINVEQQLADIELASKQKAVFESLKAGNDAMKAI 112

Query: 532 QSEVDLDDVQKLMDDTADAKAYQDELNAILGEKLSAEDEEEILAEFDNLESQLAVDEMPD 711
           QSE++++DVQKLMDDTA+AKAYQDE+N I+GEKLSAEDEEEILAEF++LE QL V ++P+
Sbjct: 113 QSEINIEDVQKLMDDTAEAKAYQDEINEIMGEKLSAEDEEEILAEFEDLEIQLTVQDLPE 172

Query: 712 VPTTEPQE-SEKIDLPDVPTRNPSLPC*ITPAESATKRKVLE 834
           VP +  +E  EK+DLPDVPT+ P      + AE +TKRKV+E
Sbjct: 173 VPPSANEEIEEKLDLPDVPTKAPV----TSDAEVSTKRKVME 210

>tr|A5BGJ1|A5BGJ1_VITVI Putative uncharacterized protein OS=Vitis vinifera
        GN=VITISV_001607 PE=4 SV=1

          Length = 226

 Score =  193 bits (490), Expect = 3e-047
 Identities = 97/147 (65%), Positives = 123/147 (83%), Gaps = 2/147 (1%)
 Frame = +1

Query: 352 K*KGEGFVSTEEETDAKDLLKQVDQWVINVEQQLADIELTSKQKAVFESLKQGSSAIKAI 531
           K K    ++ +++   ++LLKQVD WVINVEQQLADIEL SKQKAVF+SLK G++AIKAI
Sbjct:  53 KKKDRALLALKKKKAQEELLKQVDAWVINVEQQLADIELASKQKAVFDSLKAGNNAIKAI 112

Query: 532 QSEVDLDDVQKLMDDTADAKAYQDELNAILGEKLSAEDEEEILAEFDNLESQLAVDEMPD 711
           QSE++L+DVQKLMDD+A+AKAYQDE+NAILGEKLSAEDEEEILAE +NLE+Q+ + ++P 
Sbjct: 113 QSEINLEDVQKLMDDSAEAKAYQDEINAILGEKLSAEDEEEILAELENLETQITLQDLPA 172

Query: 712 VPTT--EPQESEKIDLPDVPTRNPSLP 786
           VP     P+E+EK+DLPDVPT+ P  P
Sbjct: 173 VPAAVPPPEENEKLDLPDVPTKAPVAP 199

>tr|B4FJ73|B4FJ73_MAIZE Putative uncharacterized protein OS=Zea mays PE=2 SV=1

          Length = 229

 Score =  178 bits (450), Expect = 1e-042
 Identities = 85/143 (59%), Positives = 117/143 (81%)
 Frame = +1

Query: 328 SCKRLNPRK*KGEGFVSTEEETDAKDLLKQVDQWVINVEQQLADIELTSKQKAVFESLKQ 507
           + ++L  +K +    ++ +++   ++LLKQVD W +NVEQQLADIEL SKQKAVFESLK 
Sbjct:  45 AARQLVQQKKRDRALIALKKKKAQEELLKQVDTWQMNVEQQLADIELASKQKAVFESLKA 104

Query: 508 GSSAIKAIQSEVDLDDVQKLMDDTADAKAYQDELNAILGEKLSAEDEEEILAEFDNLESQ 687
           G++A+K+IQ+E+++DDVQKLMDDTA+AKAYQDE+NA+LGE+LSAEDEE ++AEF+NLE+Q
Sbjct: 105 GNAALKSIQNEINIDDVQKLMDDTAEAKAYQDEINAVLGEQLSAEDEEAVMAEFENLEAQ 164

Query: 688 LAVDEMPDVPTTEPQESEKIDLP 756
           LAV+ +PD P TE +  EK   P
Sbjct: 165 LAVESLPDAPATEVRPEEKTKAP 187

>tr|B8AER9|B8AER9_ORYSI Putative uncharacterized protein OS=Oryza sativa subsp.
        indica GN=OsI_07907 PE=4 SV=1

          Length = 228

 Score =  178 bits (450), Expect = 1e-042
 Identities = 86/145 (59%), Positives = 118/145 (81%)
 Frame = +1

Query: 328 SCKRLNPRK*KGEGFVSTEEETDAKDLLKQVDQWVINVEQQLADIELTSKQKAVFESLKQ 507
           + ++L  +K K    ++ +++   ++LLKQVD W +NVEQQLADIEL SKQKAVF+SLK 
Sbjct:  45 AARQLVQQKKKDRALIALKKKKAQEELLKQVDTWQMNVEQQLADIELASKQKAVFDSLKA 104

Query: 508 GSSAIKAIQSEVDLDDVQKLMDDTADAKAYQDELNAILGEKLSAEDEEEILAEFDNLESQ 687
           G++A+K+IQ+E+++DDVQKLMDDTA+AKAYQDE+NA LGE+LSAEDEE ++AEF+NLE+Q
Sbjct: 105 GNAALKSIQNEINIDDVQKLMDDTAEAKAYQDEINAALGEQLSAEDEEAVMAEFENLEAQ 164

Query: 688 LAVDEMPDVPTTEPQESEKIDLPDV 762
           LAV+ +PD P TE +  EK + P V
Sbjct: 165 LAVESLPDAPVTEVRPEEKSETPAV 189

>tr|B4FQH1|B4FQH1_MAIZE Putative uncharacterized protein OS=Zea mays PE=2 SV=1

          Length = 203

 Score =  178 bits (449), Expect = 1e-042
 Identities = 84/143 (58%), Positives = 118/143 (82%)
 Frame = +1

Query: 328 SCKRLNPRK*KGEGFVSTEEETDAKDLLKQVDQWVINVEQQLADIELTSKQKAVFESLKQ 507
           + ++L  +K +    ++ +++   ++LLKQVD W +NVEQQL+DIEL SKQKAVFESLK 
Sbjct:  19 AARQLVQQKKRDRALIALKKKKAQEELLKQVDTWQMNVEQQLSDIELASKQKAVFESLKA 78

Query: 508 GSSAIKAIQSEVDLDDVQKLMDDTADAKAYQDELNAILGEKLSAEDEEEILAEFDNLESQ 687
           G++A+K+IQ+E+++DDVQKLMDDTA+AKAYQDE+NA+LGE+LSAEDEE ++AEF+NLE+Q
Sbjct:  79 GNAALKSIQNEINIDDVQKLMDDTAEAKAYQDEINAVLGEQLSAEDEEAVMAEFENLEAQ 138

Query: 688 LAVDEMPDVPTTEPQESEKIDLP 756
           LAV+ +PD P TE +  EK+  P
Sbjct: 139 LAVESLPDTPVTEVRPEEKMKAP 161

>tr|B6TFV6|B6TFV6_MAIZE Charged multivesicular body protein 6 OS=Zea mays PE=2
        SV=1

          Length = 276

 Score =  178 bits (449), Expect = 1e-042
 Identities = 84/143 (58%), Positives = 118/143 (82%)
 Frame = +1

Query: 328 SCKRLNPRK*KGEGFVSTEEETDAKDLLKQVDQWVINVEQQLADIELTSKQKAVFESLKQ 507
           + ++L  +K +    ++ +++   ++LLKQVD W +NVEQQL+DIEL SKQKAVFESLK 
Sbjct:  92 AARQLVQQKKRDRALIALKKKKAQEELLKQVDTWQMNVEQQLSDIELASKQKAVFESLKA 151

Query: 508 GSSAIKAIQSEVDLDDVQKLMDDTADAKAYQDELNAILGEKLSAEDEEEILAEFDNLESQ 687
           G++A+K+IQ+E+++DDVQKLMDDTA+AKAYQDE+NA+LGE+LSAEDEE ++AEF+NLE+Q
Sbjct: 152 GNAALKSIQNEINIDDVQKLMDDTAEAKAYQDEINAVLGEQLSAEDEEAVMAEFENLEAQ 211

Query: 688 LAVDEMPDVPTTEPQESEKIDLP 756
           LAV+ +PD P TE +  EK+  P
Sbjct: 212 LAVESLPDAPVTEVRPEEKMKAP 234

>tr|C0PNJ6|C0PNJ6_MAIZE Putative uncharacterized protein OS=Zea mays PE=2 SV=1

          Length = 229

 Score =  178 bits (449), Expect = 1e-042
 Identities = 84/143 (58%), Positives = 118/143 (82%)
 Frame = +1

Query: 328 SCKRLNPRK*KGEGFVSTEEETDAKDLLKQVDQWVINVEQQLADIELTSKQKAVFESLKQ 507
           + ++L  +K +    ++ +++   ++LLKQVD W +NVEQQL+DIEL SKQKAVFESLK 
Sbjct:  45 AARQLVQQKKRDRALIALKKKKAQEELLKQVDTWQMNVEQQLSDIELASKQKAVFESLKA 104

Query: 508 GSSAIKAIQSEVDLDDVQKLMDDTADAKAYQDELNAILGEKLSAEDEEEILAEFDNLESQ 687
           G++A+K+IQ+E+++DDVQKLMDDTA+AKAYQDE+NA+LGE+LSAEDEE ++AEF+NLE+Q
Sbjct: 105 GNAALKSIQNEINIDDVQKLMDDTAEAKAYQDEINAVLGEQLSAEDEEAVMAEFENLEAQ 164

Query: 688 LAVDEMPDVPTTEPQESEKIDLP 756
           LAV+ +PD P TE +  EK+  P
Sbjct: 165 LAVESLPDTPVTEVRPEEKMKAP 187

>tr|Q6K912|Q6K912_ORYSJ Os02g0596500 protein OS=Oryza sativa subsp. japonica
        GN=OJ1568_B05.11 PE=4 SV=1

          Length = 228

 Score =  177 bits (447), Expect = 2e-042
 Identities = 85/145 (58%), Positives = 118/145 (81%)
 Frame = +1

Query: 328 SCKRLNPRK*KGEGFVSTEEETDAKDLLKQVDQWVINVEQQLADIELTSKQKAVFESLKQ 507
           + ++L  +K K    ++ +++   ++LLKQVD W +NVEQQL+DIEL SKQKAVF+SLK 
Sbjct:  45 AARQLVQQKKKDRALIALKKKKAQEELLKQVDTWQMNVEQQLSDIELASKQKAVFDSLKA 104

Query: 508 GSSAIKAIQSEVDLDDVQKLMDDTADAKAYQDELNAILGEKLSAEDEEEILAEFDNLESQ 687
           G++A+K+IQ+E+++DDVQKLMDDTA+AKAYQDE+NA LGE+LSAEDEE ++AEF+NLE+Q
Sbjct: 105 GNAALKSIQNEINIDDVQKLMDDTAEAKAYQDEINAALGEQLSAEDEEAVMAEFENLEAQ 164

Query: 688 LAVDEMPDVPTTEPQESEKIDLPDV 762
           LAV+ +PD P TE +  EK + P V
Sbjct: 165 LAVESLPDAPVTEVRPEEKSETPAV 189

>tr|B8LM95|B8LM95_PICSI Putative uncharacterized protein OS=Picea sitchensis
        PE=2 SV=1

          Length = 250

 Score =  172 bits (434), Expect = 8e-041
 Identities = 89/169 (52%), Positives = 124/169 (73%), Gaps = 5/169 (2%)
 Frame = +1

Query: 352 K*KGEGFVSTEEETDAKDLLKQVDQWVINVEQQLADIELTSKQKAVFESLKQGSSAIKAI 531
           K K    ++ +++   ++L+KQVD W+INVEQQLADIELTSKQKAVFESLK G++AIK +
Sbjct:  53 KKKERALLALKKKKMQEELVKQVDAWLINVEQQLADIELTSKQKAVFESLKTGNNAIKVL 112

Query: 532 QSEVDLDDVQKLMDDTADAKAYQDELNAILGEKLSAEDEEEILAEFDNLESQLAVDEMPD 711
           QSE++LDD+QKLMDDTA+AK YQDE+NAILGE+LSAEDEEE+LAEF+NLES++++ ++P 
Sbjct: 113 QSEINLDDIQKLMDDTAEAKVYQDEINAILGERLSAEDEEEVLAEFENLESEISLQDLPS 172

Query: 712 VP--TTEP---QESEKIDLPDVPTRNPSLPC*ITPAESATKRKVLEEPL 843
           VP  + EP   +E  K  +P +  +         P + + +    +E L
Sbjct: 173 VPKISLEPVGKREEMKTPIPKIAAKQAIKELAEAPEQDSARNNEQDEIL 221

>tr|B9T5A6|B9T5A6_RICCO Charged multivesicular body protein, putative OS=Ricinus
        communis GN=RCOM_0053910 PE=4 SV=1

          Length = 197

 Score =  163 bits (410), Expect = 5e-038
 Identities = 81/111 (72%), Positives = 96/111 (86%), Gaps = 2/111 (1%)
 Frame = +1

Query: 460 IELTSKQKAVFESLKQGSSAIKAIQSEVDLDDVQKLMDDTADAKAYQDELNAILGEKLSA 639
           IEL SKQKAVFESLK G+  +KAIQSE++LDDVQKLMDDT +AKAYQDE+NAILGEKLSA
Sbjct:  60 IELASKQKAVFESLKAGTDTVKAIQSEINLDDVQKLMDDTEEAKAYQDEINAILGEKLSA 119

Query: 640 EDEEEILAEFDNLESQLAVDEMPDVPTTEP--QESEKIDLPDVPTRNPSLP 786
           EDEEEILAEF+NLE+QL V+++P+VPT  P  +  EK+DLPDVPT+ P  P
Sbjct: 120 EDEEEILAEFENLEAQLTVEDLPEVPTPLPSKEHEEKLDLPDVPTKPPVAP 170

>tr|A9U1V3|A9U1V3_PHYPA Predicted protein OS=Physcomitrella patens subsp. patens
        GN=PHYPADRAFT_61690 PE=4 SV=1

          Length = 234

 Score =  161 bits (406), Expect = 1e-037
 Identities = 81/137 (59%), Positives = 107/137 (78%)
 Frame = +1

Query: 334 KRLNPRK*KGEGFVSTEEETDAKDLLKQVDQWVINVEQQLADIELTSKQKAVFESLKQGS 513
           + L   K +    ++ +++   +DLLKQVD W+ NVEQQL DI++ SKQKAVFESLK G+
Sbjct:  48 RELVREKRRDRALIALKKKKVQEDLLKQVDVWLTNVEQQLLDIDVASKQKAVFESLKTGN 107

Query: 514 SAIKAIQSEVDLDDVQKLMDDTADAKAYQDELNAILGEKLSAEDEEEILAEFDNLESQLA 693
           SAIK +QSEV L+DVQKLMDDTA+A+AYQ+ELNA LGE+LSAEDEE ++AEFD LE+ +A
Sbjct: 108 SAIKQLQSEVKLEDVQKLMDDTAEAQAYQEELNAALGEQLSAEDEEAVMAEFDELETLMA 167

Query: 694 VDEMPDVPTTEPQESEK 744
            ++MPDVP    Q S++
Sbjct: 168 TEDMPDVPLPVSQPSKQ 184

>tr|B9NDG3|B9NDG3_POPTR Predicted protein (Fragment) OS=Populus trichocarpa
        GN=POPTRDRAFT_678388 PE=4 SV=1

          Length = 111

 Score =  114 bits (283), Expect = 3e-023
 Identities = 57/69 (82%), Positives = 64/69 (92%)
 Frame = +2

Query: 197 MGNMFVKKPQITDVDRAILSLKTQRRKLGQYQQQLEKVIEAEKQAARDLIRENRKERVLL 376
           MGN+FVKKP+ITDVDRAILSLKTQRRKL QYQQQLE VIEAEK AA+DLIRE RK+R LL
Sbjct:   1 MGNLFVKKPKITDVDRAILSLKTQRRKLAQYQQQLETVIEAEKLAAKDLIREKRKDRALL 60

Query: 377 ALRKKRTQK 403
           AL+KK+TQ+
Sbjct:  61 ALKKKKTQE 69

  Database: UniProt/TrEMBL
    Posted date:  Sat Aug 07 14:51:12 2010
  Number of letters in database: 3,661,877,547
  Number of sequences in database:  11,397,958

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 814,153,051,368
Number of Sequences: 11397958
Number of Extensions: 814153051368
Number of Successful Extensions: 343021171
Number of sequences better than 0.0: 0