Library    |     Search    |     Batch query    |     SNP    |     SSR  

TAIR blast output of UN11170


BLASTX 7.6.2

Query= UN11170 /QuerySize=523
        (522 letters)

Database: TAIR9 protein;
          33,410 sequences; 13,468,323 total letters
                                                                  Score    E
Sequences producing significant alignments:                       (bits) Value

TAIR9_protein||AT3G52560.1 | Symbols: UEV1D-4, MMZ4, UEV1D | UEV...    139   2e-033
TAIR9_protein||AT3G52560.2 | Symbols: UEV1D-4 | UEV1D-4 (UBIQUIT...    139   2e-033
TAIR9_protein||AT3G52560.3 | Symbols: UEV1D-4 | UEV1D-4 (UBIQUIT...    139   2e-033
TAIR9_protein||AT2G36060.1 | Symbols: MMZ3, UEV1C | ubiquitin-co...    134   3e-032
TAIR9_protein||AT2G36060.2 | Symbols: MMZ3, UEV1C | ubiquitin-co...    134   3e-032
TAIR9_protein||AT2G36060.3 | Symbols: MMZ3, UEV1C | ubiquitin-co...    131   3e-031
TAIR9_protein||AT1G23260.1 | Symbols: MMZ1, UEV1A | MMZ1 (MMS ZW...    111   3e-025
TAIR9_protein||AT1G70660.1 | Symbols: MMZ2, UEV1B | MMZ2 (MMS ZW...    102   2e-022

>TAIR9_protein||AT3G52560.1 | Symbols: UEV1D-4, MMZ4, UEV1D | UEV1D-4 (UBIQUITIN
        E2 VARIANT 1D-4); protein binding / ubiquitin-protein ligase |
        chr3:19494678-19495954 REVERSE

          Length = 147

 Score =  139 bits (348), Expect = 2e-033
 Identities = 64/77 (83%), Positives = 68/77 (88%)
 Frame = -1

Query: 522 FCDKDYPEKPPPVRFHSRINMAWVNNETGGVEPKKFGLLANWQRDYPMETILTQLKKEMF 343
           FCDKDYPEKPP VRFHSR+NMA VN+ETG V+PKKFGLLANWQR+Y ME IL QLKKEM 
Sbjct:  71 FCDKDYPEKPPTVRFHSRVNMACVNHETGVVDPKKFGLLANWQREYTMEDILVQLKKEMS 130

Query: 342 TSHNRKLVQPPEGTFF* 292
           TSHNRKLVQPPEGT F*
Sbjct: 131 TSHNRKLVQPPEGTCF* 147

>TAIR9_protein||AT3G52560.2 | Symbols: UEV1D-4 | UEV1D-4 (UBIQUITIN E2 VARIANT
        1D-4); protein binding / ubiquitin-protein ligase |
        chr3:19494678-19495954 REVERSE

          Length = 148

 Score =  139 bits (348), Expect = 2e-033
 Identities = 64/77 (83%), Positives = 68/77 (88%)
 Frame = -1

Query: 522 FCDKDYPEKPPPVRFHSRINMAWVNNETGGVEPKKFGLLANWQRDYPMETILTQLKKEMF 343
           FCDKDYPEKPP VRFHSR+NMA VN+ETG V+PKKFGLLANWQR+Y ME IL QLKKEM 
Sbjct:  72 FCDKDYPEKPPTVRFHSRVNMACVNHETGVVDPKKFGLLANWQREYTMEDILVQLKKEMS 131

Query: 342 TSHNRKLVQPPEGTFF* 292
           TSHNRKLVQPPEGT F*
Sbjct: 132 TSHNRKLVQPPEGTCF* 148

>TAIR9_protein||AT3G52560.3 | Symbols: UEV1D-4 | UEV1D-4 (UBIQUITIN E2 VARIANT
        1D-4); protein binding / ubiquitin-protein ligase |
        chr3:19494678-19495331 REVERSE

          Length = 111

 Score =  139 bits (348), Expect = 2e-033
 Identities = 64/77 (83%), Positives = 68/77 (88%)
 Frame = -1

Query: 522 FCDKDYPEKPPPVRFHSRINMAWVNNETGGVEPKKFGLLANWQRDYPMETILTQLKKEMF 343
           FCDKDYPEKPP VRFHSR+NMA VN+ETG V+PKKFGLLANWQR+Y ME IL QLKKEM 
Sbjct:  35 FCDKDYPEKPPTVRFHSRVNMACVNHETGVVDPKKFGLLANWQREYTMEDILVQLKKEMS 94

Query: 342 TSHNRKLVQPPEGTFF* 292
           TSHNRKLVQPPEGT F*
Sbjct:  95 TSHNRKLVQPPEGTCF* 111

>TAIR9_protein||AT2G36060.1 | Symbols: MMZ3, UEV1C | ubiquitin-conjugating
        enzyme family protein | chr2:15143012-15143998 REVERSE

          Length = 146

 Score =  134 bits (337), Expect = 3e-032
 Identities = 62/77 (80%), Positives = 66/77 (85%)
 Frame = -1

Query: 522 FCDKDYPEKPPPVRFHSRINMAWVNNETGGVEPKKFGLLANWQRDYPMETILTQLKKEMF 343
           FCDKDYPEKPP VRFHSRINM  VN++TG V+ KKFG+LANWQR Y ME ILTQLKKEM 
Sbjct:  70 FCDKDYPEKPPTVRFHSRINMTCVNHDTGVVDSKKFGVLANWQRQYTMEDILTQLKKEMA 129

Query: 342 TSHNRKLVQPPEGTFF* 292
            SHNRKLVQPPEGTFF*
Sbjct: 130 ASHNRKLVQPPEGTFF* 146

>TAIR9_protein||AT2G36060.2 | Symbols: MMZ3, UEV1C | ubiquitin-conjugating
        enzyme family protein | chr2:15143012-15143998 REVERSE

          Length = 147

 Score =  134 bits (337), Expect = 3e-032
 Identities = 62/77 (80%), Positives = 66/77 (85%)
 Frame = -1

Query: 522 FCDKDYPEKPPPVRFHSRINMAWVNNETGGVEPKKFGLLANWQRDYPMETILTQLKKEMF 343
           FCDKDYPEKPP VRFHSRINM  VN++TG V+ KKFG+LANWQR Y ME ILTQLKKEM 
Sbjct:  71 FCDKDYPEKPPTVRFHSRINMTCVNHDTGVVDSKKFGVLANWQRQYTMEDILTQLKKEMA 130

Query: 342 TSHNRKLVQPPEGTFF* 292
            SHNRKLVQPPEGTFF*
Sbjct: 131 ASHNRKLVQPPEGTFF* 147

>TAIR9_protein||AT2G36060.3 | Symbols: MMZ3, UEV1C | ubiquitin-conjugating
        enzyme family protein | chr2:15143012-15143998 REVERSE

          Length = 145

 Score =  131 bits (328), Expect = 3e-031
 Identities = 62/77 (80%), Positives = 66/77 (85%), Gaps = 1/77 (1%)
 Frame = -1

Query: 522 FCDKDYPEKPPPVRFHSRINMAWVNNETGGVEPKKFGLLANWQRDYPMETILTQLKKEMF 343
           FCDKDYPEKPP VRFHSRINM  VN++T GV+ KKFG+LANWQR Y ME ILTQLKKEM 
Sbjct:  70 FCDKDYPEKPPTVRFHSRINMTCVNHDT-GVDSKKFGVLANWQRQYTMEDILTQLKKEMA 128

Query: 342 TSHNRKLVQPPEGTFF* 292
            SHNRKLVQPPEGTFF*
Sbjct: 129 ASHNRKLVQPPEGTFF* 145

>TAIR9_protein||AT1G23260.1 | Symbols: MMZ1, UEV1A | MMZ1 (MMS ZWEI HOMOLOGUE
        1); protein binding / ubiquitin-protein ligase | chr1:8257209-8258573
        REVERSE

          Length = 159

 Score =  111 bits (276), Expect = 3e-025
 Identities = 51/73 (69%), Positives = 57/73 (78%)
 Frame = -1

Query: 522 FCDKDYPEKPPPVRFHSRINMAWVNNETGGVEPKKFGLLANWQRDYPMETILTQLKKEMF 343
           FC K+YPE PP VRF +RINMA VN ETG VEP  F +L NW+R+Y ME IL +LKKEM 
Sbjct:  69 FCGKEYPESPPTVRFQTRINMACVNPETGVVEPSLFPMLTNWRREYTMEDILVKLKKEMM 128

Query: 342 TSHNRKLVQPPEG 304
           TSHNRKL QPPEG
Sbjct: 129 TSHNRKLAQPPEG 141

>TAIR9_protein||AT1G70660.1 | Symbols: MMZ2, UEV1B | MMZ2 (MMS ZWEI HOMOLOGE 2);
        protein binding / ubiquitin-protein ligase | chr1:26640755-26641949
        FORWARD

          Length = 160

 Score =  102 bits (252), Expect = 2e-022
 Identities = 47/73 (64%), Positives = 55/73 (75%)
 Frame = -1

Query: 522 FCDKDYPEKPPPVRFHSRINMAWVNNETGGVEPKKFGLLANWQRDYPMETILTQLKKEMF 343
           FC KDYPE PP VRF SRINMA VN E G V+P  F +L+NW+R++ ME +L QLKKEM 
Sbjct:  69 FCGKDYPESPPTVRFQSRINMACVNPENGVVDPSHFPMLSNWRREFTMEDLLIQLKKEMM 128

Query: 342 TSHNRKLVQPPEG 304
           +S NRKL QP EG
Sbjct: 129 SSQNRKLAQPLEG 141

  Database: TAIR9 protein
    Posted date:  Wed Jul 08 15:16:08 2009
  Number of letters in database: 13,468,323
  Number of sequences in database:  33,410

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 6,102,092,508
Number of Sequences: 33410
Number of Extensions: 6102092508
Number of Successful Extensions: 221616529
Number of sequences better than 0.0: 0