Library    |     Search    |     Batch query    |     SNP    |     SSR  

TAIR blast output of UN12783


BLASTX 7.6.2

Query= UN12783 /QuerySize=804
        (803 letters)

Database: TAIR9 protein;
          33,410 sequences; 13,468,323 total letters
                                                                  Score    E
Sequences producing significant alignments:                       (bits) Value

TAIR9_protein||AT2G13840.1 | Symbols:  | PHP domain-containing p...    353   1e-097

>TAIR9_protein||AT2G13840.1 | Symbols:  | PHP domain-containing protein |
        chr2:5788616-5791057 REVERSE

          Length = 435

 Score =  353 bits (904), Expect = 1e-097
 Identities = 180/221 (81%), Positives = 199/221 (90%), Gaps = 3/221 (1%)
 Frame = +1

Query:  58 EKKRNKKKKHGGSKKTKMTSEQAEATKSVSDWLFIGSSSSSSPPLSSTDFAVTINNGSLR 237
           +KKRNKKKK     K KMT+EQ+EA KS++DWL +GSS S S   SS DFAV IN+GSLR
Sbjct:   5 KKKRNKKKKRSTGNKRKMTTEQSEAFKSITDWLILGSSPSLSS--SSDDFAVNINSGSLR 62

Query: 238 RGEKLVFELHSHSNRSDGFLSPSKLVERAHTNGVKVLSLTDHDTMAGIPEAVEAGRRFGI 417
            GEK+VFELHSHSNRSDGFLSPSK+VERA+ NGVKVLSLTDHDTMAG+PEAVEAGRRFGI
Sbjct:  63 CGEKVVFELHSHSNRSDGFLSPSKVVERAYNNGVKVLSLTDHDTMAGVPEAVEAGRRFGI 122

Query: 418 KIIPGIEISTLFRSREESGSEEPVHILAYYGTSGPAMYDELENFLVKIRDGRFVRGREMV 597
           KIIPGIEISTLF  R +SGSEEPVHILAYYGTSGPA+YDELE+FLVKIRDGRFVRGREMV
Sbjct: 123 KIIPGIEISTLFGLR-DSGSEEPVHILAYYGTSGPALYDELEDFLVKIRDGRFVRGREMV 181

Query: 598 SKLNKLKIPLRWEHVTRVAGEGVAPGKMHVARALLEAGHVE 720
            KLNKLKIPL+WEHVTR+AG+ VAPG+MHVARALLEAG+VE
Sbjct: 182 LKLNKLKIPLKWEHVTRIAGKDVAPGRMHVARALLEAGYVE 222

  Database: TAIR9 protein
    Posted date:  Wed Jul 08 15:16:08 2009
  Number of letters in database: 13,468,323
  Number of sequences in database:  33,410

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 6,805,268,470
Number of Sequences: 33410
Number of Extensions: 6805268470
Number of Successful Extensions: 232615960
Number of sequences better than 0.0: 0