Library    |     Search    |     Batch query    |     SNP    |     SSR  

TrEMBL blast output of UN13077


BLASTX 7.6.2

Query= UN13077 /QuerySize=1353
        (1352 letters)

Database: UniProt/TrEMBL;
          11,397,958 sequences; 3,661,877,547 total letters
                                                                  Score    E
Sequences producing significant alignments:                       (bits) Value

tr|B5BQV5|B5BQV5_RAPSA Cathepsin B-like cysteine protease (Fragm...    711   6e-203
tr|Q94K85|Q94K85_ARATH Cathepsin B-like cysteine protease OS=Ara...    663   1e-188
tr|Q9ZSI0|Q9ZSI0_ARATH Cathepsin B-like cysteine protease OS=Ara...    658   6e-187
tr|Q93VC9|Q93VC9_ARATH At1g02300/T6A9_10 OS=Arabidopsis thaliana...    595   6e-168
tr|B9GRU7|B9GRU7_POPTR Predicted protein OS=Populus trichocarpa ...    544   9e-153
tr|B7FJ05|B7FJ05_MEDTR Putative uncharacterized protein OS=Medic...    537   2e-150
tr|Q2HV09|Q2HV09_MEDTR Peptidase C1A, papain; Somatotropin hormo...    537   2e-150
tr|B7FK90|B7FK90_MEDTR Putative uncharacterized protein OS=Medic...    531   1e-148
tr|Q94G21|Q94G21_IPOBA Cathepsin B-like cysteine proteinase OS=I...    527   2e-147
tr|Q1HER6|Q1HER6_NICBE Cathepsin B OS=Nicotiana benthamiana GN=C...    525   6e-147
tr|C6TMR4|C6TMR4_SOYBN Putative uncharacterized protein (Fragmen...    523   2e-146
tr|Q9SQ82|Q9SQ82_IPOBA Cathepsin B-like cysteine proteinase OS=I...    523   2e-146
tr|B9DHV8|B9DHV8_ARATH AT1G02305 protein (Fragment) OS=Arabidops...    522   6e-146
tr|Q40413|Q40413_NICRU Cathepsin B-like cysteine proteinase OS=N...    520   2e-145
tr|B9I982|B9I982_POPTR Predicted protein OS=Populus trichocarpa ...    518   9e-145
tr|Q2HV10|Q2HV10_MEDTR Peptidase C1A, papain; Somatotropin hormo...    515   5e-144
tr|A2Y316|A2Y316_ORYSI Putative uncharacterized protein OS=Oryza...    507   2e-141
tr|Q5D214|Q5D214_ORYSJ Cathepsin B-like cysteine protease OS=Ory...    507   2e-141
tr|Q6ST24|Q6ST24_SOLTU Cathepsin B-like cysteine proteinase OS=S...    505   5e-141
tr|B4ESF5|B4ESF5_HORVD Papain-like cysteine proteinase OS=Hordeu...    502   5e-140

>tr|B5BQV5|B5BQV5_RAPSA Cathepsin B-like cysteine protease (Fragment)
        OS=Raphanus sativus GN=CatB PE=2 SV=1

          Length = 343

 Score =  711 bits (1834), Expect = 6e-203
 Identities = 334/338 (98%), Positives = 337/338 (99%)
 Frame = -1

Query: 1283 TKLCLVSVVLLLGLVSSSLDLQGVAAENLTKQKLSSKILQEEIVKKVNEHPNAGWKAAIN 1104
            TKLCLVSVVLLLGLVSSSL+LQGVAAENLTKQKL+SKILQEEIVKKVNEHPNAGWKAAIN
Sbjct:    6 TKLCLVSVVLLLGLVSSSLNLQGVAAENLTKQKLNSKILQEEIVKKVNEHPNAGWKAAIN 65

Query: 1103 DRFSNATVAEFKRLLGVKPTPKKLLLGVPVVSHDQSLKLPKSFDARTHWPQCTSIGKILD 924
            DRFSNATVAEFKRLLGVKPTPKKLLLGVPVVSHDQSLKLPKSFDARTHWPQCTSIGKILD
Sbjct:   66 DRFSNATVAEFKRLLGVKPTPKKLLLGVPVVSHDQSLKLPKSFDARTHWPQCTSIGKILD 125

Query:  923 QGHCGSCWAFGAVESLSDRFCIQFGMNITLSVNDLLACCGFRCGDGCDGGYPISAWQYFS 744
            QGHCGSCWAFGAVESLSDRFCIQFGMNITLSVNDLLACCGFRCGDGCDGGYPISAWQYFS
Sbjct:  126 QGHCGSCWAFGAVESLSDRFCIQFGMNITLSVNDLLACCGFRCGDGCDGGYPISAWQYFS 185

Query:  743 YSGVVTEECDPYFDQTGCSHPGCEPAYNTPQCLRKCVGRNQLWSESKHYSINTYVVESNP 564
            YSGVVTEECDPYFDQTGCSHPGCEPAYNTPQCLRKCVGRNQLWSESKHYSINTYVVESNP
Sbjct:  186 YSGVVTEECDPYFDQTGCSHPGCEPAYNTPQCLRKCVGRNQLWSESKHYSINTYVVESNP 245

Query:  563 QDIMAEIYKNGPVEVSFTVYEDFAHYKSGVYKHITGSNIGGHAVKLIGWGTTDDGEDYWL 384
            QDIMAEIYKNGPVEVSFTVYEDFAHYKSGVYKHITGSNIGGHAVKLIGWGTTDDGEDYWL
Sbjct:  246 QDIMAEIYKNGPVEVSFTVYEDFAHYKSGVYKHITGSNIGGHAVKLIGWGTTDDGEDYWL 305

Query:  383 LANQWNRSWGDDGYFMIRRGTNECGIEDEPVGGLPSTK 270
            LANQWNRSWGDDGYFMIRRGTNECGIEDEPV GLPS+K
Sbjct:  306 LANQWNRSWGDDGYFMIRRGTNECGIEDEPVAGLPSSK 343

>tr|Q94K85|Q94K85_ARATH Cathepsin B-like cysteine protease OS=Arabidopsis
        thaliana GN=At4g01620 PE=2 SV=1

          Length = 359

 Score =  663 bits (1710), Expect = 1e-188
 Identities = 307/355 (86%), Positives = 332/355 (93%), Gaps = 1/355 (0%)
 Frame = -1

Query: 1283 TKLCLVSVVLLLGLVSSSLDLQGVAAENLTKQKLSSKILQEEIVKKVNEHPNAGWKAAIN 1104
            TKLCL SV LLLGL+  + DL+G+ AE+LTKQKL SKILQ+EIVKKVNE+PNAGWKAAIN
Sbjct:    6 TKLCLASVFLLLGLL-LAFDLKGIEAESLTKQKLDSKILQDEIVKKVNENPNAGWKAAIN 64

Query: 1103 DRFSNATVAEFKRLLGVKPTPKKLLLGVPVVSHDQSLKLPKSFDARTHWPQCTSIGKILD 924
            DRFSNATVAEFKRLLGVKPTPKK  LGVP+VSHD SLKLPK+FDART WPQCTSIG ILD
Sbjct:   65 DRFSNATVAEFKRLLGVKPTPKKHFLGVPIVSHDPSLKLPKAFDARTAWPQCTSIGNILD 124

Query:  923 QGHCGSCWAFGAVESLSDRFCIQFGMNITLSVNDLLACCGFRCGDGCDGGYPISAWQYFS 744
            QGHCGSCWAFGAVESLSDRFCIQFGMNI+LSVNDLLACCGFRCGDGCDGGYPI+AWQYFS
Sbjct:  125 QGHCGSCWAFGAVESLSDRFCIQFGMNISLSVNDLLACCGFRCGDGCDGGYPIAAWQYFS 184

Query:  743 YSGVVTEECDPYFDQTGCSHPGCEPAYNTPQCLRKCVGRNQLWSESKHYSINTYVVESNP 564
            YSGVVTEECDPYFD TGCSHPGCEPAY TP+C RKCV  N+LWSESKHYS++TY V+SNP
Sbjct:  185 YSGVVTEECDPYFDNTGCSHPGCEPAYPTPKCSRKCVSDNKLWSESKHYSVSTYTVKSNP 244

Query:  563 QDIMAEIYKNGPVEVSFTVYEDFAHYKSGVYKHITGSNIGGHAVKLIGWGTTDDGEDYWL 384
            QDIMAE+YKNGPVEVSFTVYEDFAHYKSGVYKHITGSNIGGHAVKLIGWGT+ +GEDYWL
Sbjct:  245 QDIMAEVYKNGPVEVSFTVYEDFAHYKSGVYKHITGSNIGGHAVKLIGWGTSSEGEDYWL 304

Query:  383 LANQWNRSWGDDGYFMIRRGTNECGIEDEPVGGLPSTKNVFKVTTGSDEISVASV 219
            +ANQWNR WGDDGYFMIRRGTNECGIEDEPV GLPS+KNVF+V TGS+++ VASV
Sbjct:  305 MANQWNRGWGDDGYFMIRRGTNECGIEDEPVAGLPSSKNVFRVDTGSNDLPVASV 359

>tr|Q9ZSI0|Q9ZSI0_ARATH Cathepsin B-like cysteine protease OS=Arabidopsis
        thaliana GN=T15B16.17a PE=3 SV=1

          Length = 359

 Score =  658 bits (1696), Expect = 6e-187
 Identities = 305/355 (85%), Positives = 330/355 (92%), Gaps = 1/355 (0%)
 Frame = -1

Query: 1283 TKLCLVSVVLLLGLVSSSLDLQGVAAENLTKQKLSSKILQEEIVKKVNEHPNAGWKAAIN 1104
            TKLCL SV LLLGL+  + DL+G+ AE+LTKQKL SKILQ+EIVKKVNE+PNAGWKAAIN
Sbjct:    6 TKLCLASVFLLLGLL-LAFDLKGIEAESLTKQKLDSKILQDEIVKKVNENPNAGWKAAIN 64

Query: 1103 DRFSNATVAEFKRLLGVKPTPKKLLLGVPVVSHDQSLKLPKSFDARTHWPQCTSIGKILD 924
            DRFSNATVAEFKRLLGVKPTPKK  LGVP+VSHD SLKLPK+FDART WPQCTSIG IL 
Sbjct:   65 DRFSNATVAEFKRLLGVKPTPKKHFLGVPIVSHDPSLKLPKAFDARTAWPQCTSIGNILG 124

Query:  923 QGHCGSCWAFGAVESLSDRFCIQFGMNITLSVNDLLACCGFRCGDGCDGGYPISAWQYFS 744
             GHCGSCWAFGAVESLSDRFCIQFGMNI+LSVNDLLACCGFRCGDGCDGGYPI+AWQYFS
Sbjct:  125 LGHCGSCWAFGAVESLSDRFCIQFGMNISLSVNDLLACCGFRCGDGCDGGYPIAAWQYFS 184

Query:  743 YSGVVTEECDPYFDQTGCSHPGCEPAYNTPQCLRKCVGRNQLWSESKHYSINTYVVESNP 564
            YSGVVTEECDPYFD TGCSHPGCEPAY TP+C RKCV  N+LWSESKHYS++TY V+SNP
Sbjct:  185 YSGVVTEECDPYFDNTGCSHPGCEPAYPTPKCSRKCVSDNKLWSESKHYSVSTYTVKSNP 244

Query:  563 QDIMAEIYKNGPVEVSFTVYEDFAHYKSGVYKHITGSNIGGHAVKLIGWGTTDDGEDYWL 384
            QDIMAE+YKNGPVEVSFTVYEDFAHYKSGVYKHITGSNIGGHAVKLIGWGT+ +GEDYWL
Sbjct:  245 QDIMAEVYKNGPVEVSFTVYEDFAHYKSGVYKHITGSNIGGHAVKLIGWGTSSEGEDYWL 304

Query:  383 LANQWNRSWGDDGYFMIRRGTNECGIEDEPVGGLPSTKNVFKVTTGSDEISVASV 219
            +ANQWNR WGDDGYFMIRRGTNECGIEDEPV GLPS+KNVF+V TGS+++ VASV
Sbjct:  305 MANQWNRGWGDDGYFMIRRGTNECGIEDEPVAGLPSSKNVFRVDTGSNDLPVASV 359

>tr|Q93VC9|Q93VC9_ARATH At1g02300/T6A9_10 OS=Arabidopsis thaliana GN=At1g02305
        PE=2 SV=1

          Length = 362

 Score =  595 bits (1532), Expect = 6e-168
 Identities = 278/361 (77%), Positives = 310/361 (85%), Gaps = 1/361 (0%)
 Frame = -1

Query: 1301 MAADSTTKLCLVSVVLLLGLVSSSLD-LQGVAAENLTKQKLSSKILQEEIVKKVNEHPNA 1125
            MA +    L   SV   LGL+ SS + LQG+AAENL+KQKL+S ILQ EIVK+VNE+PNA
Sbjct:    1 MADNCIRLLHSASVFFCLGLLISSFNLLQGIAAENLSKQKLTSWILQNEIVKEVNENPNA 60

Query: 1124 GWKAAINDRFSNATVAEFKRLLGVKPTPKKLLLGVPVVSHDQSLKLPKSFDARTHWPQCT 945
            GWKA+ NDRF+NATVAEFKRLLGVKPTPK   LGVP+VSHD SLKLPK FDART W QCT
Sbjct:   61 GWKASFNDRFANATVAEFKRLLGVKPTPKTEFLGVPIVSHDISLKLPKEFDARTAWSQCT 120

Query:  944 SIGKILDQGHCGSCWAFGAVESLSDRFCIQFGMNITLSVNDLLACCGFRCGDGCDGGYPI 765
            SIG+ILDQGHCGSCWAFGAVESLSDRFCI++ MN++LSVNDLLACCGF CG GC+GGYPI
Sbjct:  121 SIGRILDQGHCGSCWAFGAVESLSDRFCIKYNMNVSLSVNDLLACCGFLCGQGCNGGYPI 180

Query:  764 SAWQYFSYSGVVTEECDPYFDQTGCSHPGCEPAYNTPQCLRKCVGRNQLWSESKHYSINT 585
            +AW+YF + GVVTEECDPYFD TGCSHPGCEPAY TP+C RKCV  NQLW ESKHY ++ 
Sbjct:  181 AAWRYFKHHGVVTEECDPYFDNTGCSHPGCEPAYPTPKCARKCVSGNQLWRESKHYGVSA 240

Query:  584 YVVESNPQDIMAEIYKNGPVEVSFTVYEDFAHYKSGVYKHITGSNIGGHAVKLIGWGTTD 405
            Y V S+P DIMAE+YKNGPVEV+FTVYEDFAHYKSGVYKHITG+NIGGHAVKLIGWGT+D
Sbjct:  241 YKVRSHPDDIMAEVYKNGPVEVAFTVYEDFAHYKSGVYKHITGTNIGGHAVKLIGWGTSD 300

Query:  404 DGEDYWLLANQWNRSWGDDGYFMIRRGTNECGIEDEPVGGLPSTKNVFKVTTGSDEISVA 225
            DGEDYWLLANQWNRSWGDDGYF IRRGTNECGIE   V GLPS +NV K  T SD++ V+
Sbjct:  301 DGEDYWLLANQWNRSWGDDGYFKIRRGTNECGIEHGVVAGLPSDRNVVKGITTSDDLLVS 360

Query:  224 S 222
            S
Sbjct:  361 S 361

>tr|B9GRU7|B9GRU7_POPTR Predicted protein OS=Populus trichocarpa
        GN=POPTRDRAFT_552399 PE=3 SV=1

          Length = 357

 Score =  544 bits (1401), Expect = 9e-153
 Identities = 247/354 (69%), Positives = 290/354 (81%)
 Frame = -1

Query: 1283 TKLCLVSVVLLLGLVSSSLDLQGVAAENLTKQKLSSKILQEEIVKKVNEHPNAGWKAAIN 1104
            T LC  +++LLL     +   Q +A E ++  KL+S+ILQ+ I+KKVN +P AGWKA +N
Sbjct:    3 TSLCFSTLLLLLIGAIFTFQSQVIAVEPVSDLKLNSRILQDSILKKVNGNPKAGWKATMN 62

Query: 1103 DRFSNATVAEFKRLLGVKPTPKKLLLGVPVVSHDQSLKLPKSFDARTHWPQCTSIGKILD 924
              FSN TVA+FK LLGVKPTPK+ L G+PV+SH +SL+LP+ FDART WPQC++IGKILD
Sbjct:   63 HHFSNYTVAQFKYLLGVKPTPKEELRGIPVISHPKSLRLPEEFDARTAWPQCSTIGKILD 122

Query:  923 QGHCGSCWAFGAVESLSDRFCIQFGMNITLSVNDLLACCGFRCGDGCDGGYPISAWQYFS 744
            QGHCGSCWAFGAVESLSDRFCI +GMNI+LSVNDLLACCGF CG GC+GGYPISAW+YF 
Sbjct:  123 QGHCGSCWAFGAVESLSDRFCIHYGMNISLSVNDLLACCGFLCGSGCNGGYPISAWRYFV 182

Query:  743 YSGVVTEECDPYFDQTGCSHPGCEPAYNTPQCLRKCVGRNQLWSESKHYSINTYVVESNP 564
            + GVVTEECDPYFD  GCSHPGCEP Y TP+C RKCV +NQLW +SKHY +  Y ++S+P
Sbjct:  183 HHGVVTEECDPYFDDIGCSHPGCEPGYPTPKCARKCVNKNQLWKKSKHYGVKPYRIDSDP 242

Query:  563 QDIMAEIYKNGPVEVSFTVYEDFAHYKSGVYKHITGSNIGGHAVKLIGWGTTDDGEDYWL 384
            + IMAEIYKNGPVEV+FTVYEDFAHYKSGVYKHITG  +GGHAVKLIGWGT++DGE YWL
Sbjct:  243 ESIMAEIYKNGPVEVAFTVYEDFAHYKSGVYKHITGGMMGGHAVKLIGWGTSEDGEAYWL 302

Query:  383 LANQWNRSWGDDGYFMIRRGTNECGIEDEPVGGLPSTKNVFKVTTGSDEISVAS 222
            LANQWNR WGDDGYF IRRGTNECGIE + V GLPST+N+ +     D    AS
Sbjct:  303 LANQWNRGWGDDGYFKIRRGTNECGIEGDVVAGLPSTRNLVREVVSVDAREDAS 356

>tr|B7FJ05|B7FJ05_MEDTR Putative uncharacterized protein OS=Medicago truncatula
        PE=2 SV=1

          Length = 359

 Score =  537 bits (1381), Expect = 2e-150
 Identities = 242/322 (75%), Positives = 273/322 (84%)
 Frame = -1

Query: 1205 ENLTKQKLSSKILQEEIVKKVNEHPNAGWKAAINDRFSNATVAEFKRLLGVKPTPKKLLL 1026
            E L   KL+S ILQE I K++NE+P AGW+AAIN RFSN TV +FKRLLGVK  PKK LL
Sbjct:   31 EKLNGLKLNSHILQESIAKQINENPEAGWEAAINPRFSNFTVGQFKRLLGVKQAPKKELL 90

Query: 1025 GVPVVSHDQSLKLPKSFDARTHWPQCTSIGKILDQGHCGSCWAFGAVESLSDRFCIQFGM 846
              PVV+H +SLKLPK FDART W QC++IGKILDQGHCGSCWAFGAVESL DRFCI F M
Sbjct:   91 STPVVTHPKSLKLPKEFDARTAWSQCSTIGKILDQGHCGSCWAFGAVESLQDRFCIHFDM 150

Query:  845 NITLSVNDLLACCGFRCGDGCDGGYPISAWQYFSYSGVVTEECDPYFDQTGCSHPGCEPA 666
            NI+LSVNDLLACCGF CG GCDGG PI AW+Y ++ GVVTEECDPYFDQ GCSHPGCEPA
Sbjct:  151 NISLSVNDLLACCGFLCGAGCDGGTPIYAWRYLAHHGVVTEECDPYFDQIGCSHPGCEPA 210

Query:  665 YNTPQCLRKCVGRNQLWSESKHYSINTYVVESNPQDIMAEIYKNGPVEVSFTVYEDFAHY 486
            Y TP+C+RKCV  NQ+W  SKHYS+  Y V+S+PQDIMAE+YKNGPVEV+FTV+EDFAHY
Sbjct:  211 YQTPKCVRKCVKGNQIWKRSKHYSVKAYRVKSDPQDIMAEVYKNGPVEVAFTVFEDFAHY 270

Query:  485 KSGVYKHITGSNIGGHAVKLIGWGTTDDGEDYWLLANQWNRSWGDDGYFMIRRGTNECGI 306
            KSGVYKHITGS +GGHAVKLIGWGT+D+GEDYWLLANQWN +WGDDGYF I+RGTNECGI
Sbjct:  271 KSGVYKHITGSALGGHAVKLIGWGTSDEGEDYWLLANQWNTNWGDDGYFKIKRGTNECGI 330

Query:  305 EDEPVGGLPSTKNVFKVTTGSD 240
            ED+   GLPSTKN+ +  T  D
Sbjct:  331 EDDVTAGLPSTKNIVREVTDMD 352

>tr|Q2HV09|Q2HV09_MEDTR Peptidase C1A, papain; Somatotropin hormone; Peptidase
        C1, propeptide OS=Medicago truncatula GN=MtrDRAFT_AC149038g3v2 PE=3
        SV=1

          Length = 357

 Score =  537 bits (1381), Expect = 2e-150
 Identities = 242/322 (75%), Positives = 273/322 (84%)
 Frame = -1

Query: 1205 ENLTKQKLSSKILQEEIVKKVNEHPNAGWKAAINDRFSNATVAEFKRLLGVKPTPKKLLL 1026
            E L   KL+S ILQE I K++NE+P AGW+AAIN RFSN TV +FKRLLGVK  PKK LL
Sbjct:   29 EKLNGLKLNSHILQESIAKQINENPEAGWEAAINPRFSNFTVGQFKRLLGVKQAPKKELL 88

Query: 1025 GVPVVSHDQSLKLPKSFDARTHWPQCTSIGKILDQGHCGSCWAFGAVESLSDRFCIQFGM 846
              PVV+H +SLKLPK FDART W QC++IGKILDQGHCGSCWAFGAVESL DRFCI F M
Sbjct:   89 STPVVTHPKSLKLPKEFDARTAWSQCSTIGKILDQGHCGSCWAFGAVESLQDRFCIHFDM 148

Query:  845 NITLSVNDLLACCGFRCGDGCDGGYPISAWQYFSYSGVVTEECDPYFDQTGCSHPGCEPA 666
            NI+LSVNDLLACCGF CG GCDGG PI AW+Y ++ GVVTEECDPYFDQ GCSHPGCEPA
Sbjct:  149 NISLSVNDLLACCGFLCGAGCDGGTPIYAWRYLAHHGVVTEECDPYFDQIGCSHPGCEPA 208

Query:  665 YNTPQCLRKCVGRNQLWSESKHYSINTYVVESNPQDIMAEIYKNGPVEVSFTVYEDFAHY 486
            Y TP+C+RKCV  NQ+W  SKHYS+  Y V+S+PQDIMAE+YKNGPVEV+FTV+EDFAHY
Sbjct:  209 YQTPKCVRKCVKGNQIWKRSKHYSVKAYRVKSDPQDIMAEVYKNGPVEVAFTVFEDFAHY 268

Query:  485 KSGVYKHITGSNIGGHAVKLIGWGTTDDGEDYWLLANQWNRSWGDDGYFMIRRGTNECGI 306
            KSGVYKHITGS +GGHAVKLIGWGT+D+GEDYWLLANQWN +WGDDGYF I+RGTNECGI
Sbjct:  269 KSGVYKHITGSALGGHAVKLIGWGTSDEGEDYWLLANQWNTNWGDDGYFKIKRGTNECGI 328

Query:  305 EDEPVGGLPSTKNVFKVTTGSD 240
            ED+   GLPSTKN+ +  T  D
Sbjct:  329 EDDVTAGLPSTKNIVREVTDMD 350

>tr|B7FK90|B7FK90_MEDTR Putative uncharacterized protein OS=Medicago truncatula
        PE=2 SV=1

          Length = 359

 Score =  531 bits (1366), Expect = 1e-148
 Identities = 239/322 (74%), Positives = 270/322 (83%)
 Frame = -1

Query: 1205 ENLTKQKLSSKILQEEIVKKVNEHPNAGWKAAINDRFSNATVAEFKRLLGVKPTPKKLLL 1026
            E L   KL+S ILQE I K++NE+P AGW+AAIN RFSN TV +FKRLLGVK  PKK LL
Sbjct:   31 EKLNGLKLNSHILQESIAKQINENPEAGWEAAINPRFSNFTVGQFKRLLGVKQAPKKELL 90

Query: 1025 GVPVVSHDQSLKLPKSFDARTHWPQCTSIGKILDQGHCGSCWAFGAVESLSDRFCIQFGM 846
              PVV+H +SLKLPK FDAR  W QC++IGKILDQGHCGSCWAFGAVESL DRFC  F M
Sbjct:   91 STPVVTHPKSLKLPKEFDARAAWSQCSTIGKILDQGHCGSCWAFGAVESLQDRFCSHFDM 150

Query:  845 NITLSVNDLLACCGFRCGDGCDGGYPISAWQYFSYSGVVTEECDPYFDQTGCSHPGCEPA 666
            NI+LSVNDLLACCGF CG GCDGG PI AW+Y ++ GVVTEECDPYFDQ GCSHPGCEPA
Sbjct:  151 NISLSVNDLLACCGFLCGAGCDGGTPIYAWRYLAHHGVVTEECDPYFDQIGCSHPGCEPA 210

Query:  665 YNTPQCLRKCVGRNQLWSESKHYSINTYVVESNPQDIMAEIYKNGPVEVSFTVYEDFAHY 486
            Y TP+C+RKCV  NQ+W  SKHYS+  Y V+S+PQDIM E+YKNGPVEV+FTV+EDFAHY
Sbjct:  211 YQTPKCVRKCVKGNQIWKRSKHYSVKAYRVKSDPQDIMTEVYKNGPVEVAFTVFEDFAHY 270

Query:  485 KSGVYKHITGSNIGGHAVKLIGWGTTDDGEDYWLLANQWNRSWGDDGYFMIRRGTNECGI 306
            KSGVYKHITGS +GGHAVKLIGWGT+D+GEDYWLLANQWN +WGDDGYF I+RGTNECGI
Sbjct:  271 KSGVYKHITGSALGGHAVKLIGWGTSDEGEDYWLLANQWNTNWGDDGYFKIKRGTNECGI 330

Query:  305 EDEPVGGLPSTKNVFKVTTGSD 240
            ED+   GLPSTKN+ +  T  D
Sbjct:  331 EDDVTAGLPSTKNIVREVTDMD 352

>tr|Q94G21|Q94G21_IPOBA Cathepsin B-like cysteine proteinase OS=Ipomoea batatas
        PE=3 SV=1

          Length = 352

 Score =  527 bits (1356), Expect = 2e-147
 Identities = 246/351 (70%), Positives = 285/351 (81%), Gaps = 3/351 (0%)
 Frame = -1

Query: 1268 VSVVLLLGLVSSSLDLQGVAAENLTKQKLSSKILQEEIVKKVNEHPNAGWKAAINDRFSN 1089
            +  +LL+G + S L LQ VA + +T  ++  KILQ+EIVK VNE+P AGWKA +N RFS+
Sbjct:    4 IKTLLLIGAI-SLLILQVVAVKPVTLTEVDPKILQDEIVKTVNENPEAGWKADMNPRFSD 62

Query: 1088 ATVAEFKRLLGVKPTPKKLLLGVPVVSHDQSLKLPKSFDARTHWPQCTSIGKILDQGHCG 909
             TV++FKRLLGVK  PK LL   PVV+H + ++LPK+FDART WPQC SI  ILDQGHCG
Sbjct:   63 FTVSQFKRLLGVKKAPKSLLKRTPVVTHSKEIELPKTFDARTAWPQCLSIADILDQGHCG 122

Query:  908 SCWAFGAVESLSDRFCIQFGMNITLSVNDLLACCGFRCGDGCDGGYPISAWQYFSYSGVV 729
            SCWAFGAVESL+DRFCI +G N+TLSVNDLLACCGF CG+GCDGGYPI+AWQYF  +GVV
Sbjct:  123 SCWAFGAVESLTDRFCIHYGTNVTLSVNDLLACCGFLCGEGCDGGYPIAAWQYFKRTGVV 182

Query:  728 TEECDPYFDQTGCSHPGCEPAYNTPQCLRKCVGRNQLWSESKHYSINTYVVESNPQDIMA 549
            T ECDPYFDQTGCSHPGCEPAY TP C +KCV +N LWSESKH+S+N Y V S+   IM 
Sbjct:  183 TSECDPYFDQTGCSHPGCEPAYPTPACEKKCVKKNLLWSESKHFSVNAYRVNSDQHSIMT 242

Query:  548 EIYKNGPVEVSFTVYEDFAHYKSGVYKHITGSNIGGHAVKLIGWGTTDDGEDYWLLANQW 369
            E+Y NGP EVSFTVYEDFAHYKSGVYKH+TGS +GGHAVKLIGWGT++DGEDYWLLANQW
Sbjct:  243 EVYTNGPAEVSFTVYEDFAHYKSGVYKHVTGSEMGGHAVKLIGWGTSEDGEDYWLLANQW 302

Query:  368 NRSWGDDGYFMIRRGTNECGIEDEPVGGLPSTKNV-FKVTTGSDEISVASV 219
            NRSWGDDGYF I RGTNECGIED    G+PSTKN+  +     D+  VASV
Sbjct:  303 NRSWGDDGYFKIIRGTNECGIED-VTAGMPSTKNLDIESGVRDDDSLVASV 352

>tr|Q1HER6|Q1HER6_NICBE Cathepsin B OS=Nicotiana benthamiana GN=CathB PE=2 SV=1

          Length = 356

 Score =  525 bits (1351), Expect = 6e-147
 Identities = 236/338 (69%), Positives = 283/338 (83%), Gaps = 2/338 (0%)
 Frame = -1

Query: 1277 LCLVSVVLLLGLVSSSLDLQGVAAENLTKQKLSSKILQEEIVKKVNEHPNAGWKAAINDR 1098
            + LV+ +LL+G  +S L LQ VA + +++ K  S ILQ+ IVK+VNE+  AGWKAA+N R
Sbjct:    6 MSLVTFLLLIG--ASVLVLQVVAEQPISQAKAESAILQDSIVKQVNENEKAGWKAALNPR 63

Query: 1097 FSNATVAEFKRLLGVKPTPKKLLLGVPVVSHDQSLKLPKSFDARTHWPQCTSIGKILDQG 918
            FSN TV++FKRLLGVKPT K  L G+P+++H + L+LP+ FDAR  WP C++IG+ILDQG
Sbjct:   64 FSNFTVSQFKRLLGVKPTRKGDLKGIPILTHPKLLELPQEFDARVAWPNCSTIGRILDQG 123

Query:  917 HCGSCWAFGAVESLSDRFCIQFGMNITLSVNDLLACCGFRCGDGCDGGYPISAWQYFSYS 738
            HCGSCWAFGAVESLSDRFCI +G+NI+LS NDLLACCGF CGDGCDGGYP+ AW+YF   
Sbjct:  124 HCGSCWAFGAVESLSDRFCIHYGLNISLSANDLLACCGFLCGDGCDGGYPLQAWKYFVRK 183

Query:  737 GVVTEECDPYFDQTGCSHPGCEPAYNTPQCLRKCVGRNQLWSESKHYSINTYVVESNPQD 558
            GVVT+ECDPYFD  GCSHPGCEPAY TP+C RKCV +N LWS+SKH+ +N Y++ S+P  
Sbjct:  184 GVVTDECDPYFDNEGCSHPGCEPAYPTPKCHRKCVKQNLLWSKSKHFGVNAYMISSDPHS 243

Query:  557 IMAEIYKNGPVEVSFTVYEDFAHYKSGVYKHITGSNIGGHAVKLIGWGTTDDGEDYWLLA 378
            IM E+YKNGPVEVSFTVYEDFAHYKSGVYKH+TG  +GGHAVKLIGWGT++DGEDYWLLA
Sbjct:  244 IMTELYKNGPVEVSFTVYEDFAHYKSGVYKHVTGDVMGGHAVKLIGWGTSEDGEDYWLLA 303

Query:  377 NQWNRSWGDDGYFMIRRGTNECGIEDEPVGGLPSTKNV 264
            NQWNR WGDDGYF IRRGT+EC IEDE V GLPS +N+
Sbjct:  304 NQWNRGWGDDGYFKIRRGTDECEIEDEVVAGLPSARNL 341

>tr|C6TMR4|C6TMR4_SOYBN Putative uncharacterized protein (Fragment) OS=Glycine
        max PE=2 SV=1

          Length = 327

 Score =  523 bits (1346), Expect = 2e-146
 Identities = 238/327 (72%), Positives = 273/327 (83%), Gaps = 2/327 (0%)
 Frame = -1

Query: 1289 STTKLCLVSVVLLLGLVSSSLDLQGVAAENLTKQKLSSKILQEEIVKKVNEHPNAGWKAA 1110
            ST  L L +  LLL   +S L + G  A+ LT  KL+S ILQE   K++NE+P AGW+AA
Sbjct:    3 STHLLPLATFFLLLS--ASYLQIAGAEAQPLTSLKLNSHILQESTAKEINENPEAGWEAA 60

Query: 1109 INDRFSNATVAEFKRLLGVKPTPKKLLLGVPVVSHDQSLKLPKSFDARTHWPQCTSIGKI 930
            IN RFSN TV +FKRLLGVKP PKK L   P +SH ++LKLPK+FDART W QC++IG+I
Sbjct:   61 INPRFSNYTVEQFKRLLGVKPMPKKELRSTPAISHPKTLKLPKNFDARTAWSQCSTIGRI 120

Query:  929 LDQGHCGSCWAFGAVESLSDRFCIQFGMNITLSVNDLLACCGFRCGDGCDGGYPISAWQY 750
            LDQGHCGSCWAFGAVESLSDRFCI F +NI+LSVNDLLACCGF CG GCDGGYP+ AW+Y
Sbjct:  121 LDQGHCGSCWAFGAVESLSDRFCIHFDVNISLSVNDLLACCGFLCGSGCDGGYPLYAWRY 180

Query:  749 FSYSGVVTEECDPYFDQTGCSHPGCEPAYNTPQCLRKCVGRNQLWSESKHYSINTYVVES 570
             ++ GVVTEECDPYFDQ GCSHPGCEPAY TP+C++KCV  NQ+W +SKHYS++ Y V S
Sbjct:  181 LAHHGVVTEECDPYFDQIGCSHPGCEPAYRTPKCVKKCVSGNQVWKKSKHYSVSAYRVNS 240

Query:  569 NPQDIMAEIYKNGPVEVSFTVYEDFAHYKSGVYKHITGSNIGGHAVKLIGWGTTDDGEDY 390
            +P DIMAE+YKNGPVEV+FTVYEDFA+YKSGVYKHITG  +GGHAVKLIGWGTTDDGEDY
Sbjct:  241 DPHDIMAEVYKNGPVEVAFTVYEDFAYYKSGVYKHITGYELGGHAVKLIGWGTTDDGEDY 300

Query:  389 WLLANQWNRSWGDDGYFMIRRGTNECG 309
            WLLANQWNR WGDDGYF IRRGTNECG
Sbjct:  301 WLLANQWNREWGDDGYFKIRRGTNECG 327

>tr|Q9SQ82|Q9SQ82_IPOBA Cathepsin B-like cysteine proteinase OS=Ipomoea batatas
        GN=CathB PE=2 SV=1

          Length = 352

 Score =  523 bits (1346), Expect = 2e-146
 Identities = 245/351 (69%), Positives = 283/351 (80%), Gaps = 3/351 (0%)
 Frame = -1

Query: 1268 VSVVLLLGLVSSSLDLQGVAAENLTKQKLSSKILQEEIVKKVNEHPNAGWKAAINDRFSN 1089
            +  +LL+G + S L LQ VA + +T  ++  KILQ+EIVK VNE+P AGWKA +N RFS+
Sbjct:    4 IKTLLLIGAI-SLLILQVVAVKPVTLTEVDPKILQDEIVKTVNENPEAGWKADMNPRFSD 62

Query: 1088 ATVAEFKRLLGVKPTPKKLLLGVPVVSHDQSLKLPKSFDARTHWPQCTSIGKILDQGHCG 909
             TV++FKRLLGVK  PK LL   PVV+H + ++LPK+FDART WPQC SI  ILDQGHCG
Sbjct:   63 FTVSQFKRLLGVKKAPKSLLKRTPVVTHSKEIELPKTFDARTAWPQCLSIADILDQGHCG 122

Query:  908 SCWAFGAVESLSDRFCIQFGMNITLSVNDLLACCGFRCGDGCDGGYPISAWQYFSYSGVV 729
            SCWAFGAVESL+DRFCI +G N+TLSVNDLLACCGF CG+GCDGGYPI+AWQYF  +GVV
Sbjct:  123 SCWAFGAVESLTDRFCIHYGTNVTLSVNDLLACCGFLCGEGCDGGYPIAAWQYFKRTGVV 182

Query:  728 TEECDPYFDQTGCSHPGCEPAYNTPQCLRKCVGRNQLWSESKHYSINTYVVESNPQDIMA 549
            T ECDPYFDQTGCSHPGCEPAY TP C +KCV +N LWSESKH+S+N Y V S+   IM 
Sbjct:  183 TSECDPYFDQTGCSHPGCEPAYPTPACEKKCVKKNLLWSESKHFSVNAYRVNSDQHSIMT 242

Query:  548 EIYKNGPVEVSFTVYEDFAHYKSGVYKHITGSNIGGHAVKLIGWGTTDDGEDYWLLANQW 369
            E+Y NGP EVSFTVYEDFAHYKSGVYKH+TGS +GGHAVKLIGWGT++DGEDYWLLANQW
Sbjct:  243 EVYTNGPAEVSFTVYEDFAHYKSGVYKHVTGSEMGGHAVKLIGWGTSEDGEDYWLLANQW 302

Query:  368 NRSWGDDGYFMIRRGTNECGIEDEPVGGLPSTKNV-FKVTTGSDEISVASV 219
            NRSWG DGYF I RGTNECGIED    G PSTKN+  +     D+  VASV
Sbjct:  303 NRSWGGDGYFKIIRGTNECGIED-VTAGTPSTKNLDIESGVRDDDSLVASV 352

>tr|B9DHV8|B9DHV8_ARATH AT1G02305 protein (Fragment) OS=Arabidopsis thaliana
        GN=AT1G02305 PE=2 SV=1

          Length = 293

 Score =  522 bits (1342), Expect = 6e-146
 Identities = 235/292 (80%), Positives = 258/292 (88%)
 Frame = -1

Query: 1097 FSNATVAEFKRLLGVKPTPKKLLLGVPVVSHDQSLKLPKSFDARTHWPQCTSIGKILDQG 918
            F+NATVAEFKRLLGVKPTPK   LGVP+VSHD SLKLPK FDART W QCTSIG+ILDQG
Sbjct:    1 FANATVAEFKRLLGVKPTPKTEFLGVPIVSHDISLKLPKEFDARTAWSQCTSIGRILDQG 60

Query:  917 HCGSCWAFGAVESLSDRFCIQFGMNITLSVNDLLACCGFRCGDGCDGGYPISAWQYFSYS 738
            HCGSCWAFGAVESLSDRFCI++ MN++LSVNDLLACCGF CG GC+GGYPI+AW+YF + 
Sbjct:   61 HCGSCWAFGAVESLSDRFCIKYNMNVSLSVNDLLACCGFLCGQGCNGGYPIAAWRYFKHH 120

Query:  737 GVVTEECDPYFDQTGCSHPGCEPAYNTPQCLRKCVGRNQLWSESKHYSINTYVVESNPQD 558
            GVVTEECDPYFD TGCSHPGCEPAY TP+C RKCV  NQLW ESKHY ++ Y V S+P D
Sbjct:  121 GVVTEECDPYFDNTGCSHPGCEPAYPTPKCARKCVSGNQLWRESKHYGVSAYKVRSHPDD 180

Query:  557 IMAEIYKNGPVEVSFTVYEDFAHYKSGVYKHITGSNIGGHAVKLIGWGTTDDGEDYWLLA 378
            IMAE+YKNGPVEV+FTVYEDFAHYKSGVYKHITG+NIGGHAVKLIGWGT+DDGEDYWLLA
Sbjct:  181 IMAEVYKNGPVEVAFTVYEDFAHYKSGVYKHITGTNIGGHAVKLIGWGTSDDGEDYWLLA 240

Query:  377 NQWNRSWGDDGYFMIRRGTNECGIEDEPVGGLPSTKNVFKVTTGSDEISVAS 222
            NQWNRSWGDDGYF IRRGTNECGIE   V GLPS +NV K  T SD++ V+S
Sbjct:  241 NQWNRSWGDDGYFKIRRGTNECGIEHGVVAGLPSDRNVVKGITTSDDLLVSS 292

>tr|Q40413|Q40413_NICRU Cathepsin B-like cysteine proteinase OS=Nicotiana
        rustica GN=catch B PE=2 SV=1

          Length = 356

 Score =  520 bits (1337), Expect = 2e-145
 Identities = 233/338 (68%), Positives = 279/338 (82%), Gaps = 2/338 (0%)
 Frame = -1

Query: 1277 LCLVSVVLLLGLVSSSLDLQGVAAENLTKQKLSSKILQEEIVKKVNEHPNAGWKAAINDR 1098
            + L ++ LL+G  +S + LQ VA + +++ K  S ILQ+ IVK+VNE+  AGWKAA+N R
Sbjct:    6 MSLTTLFLLIG--ASIIVLQVVAEQPISQAKAESAILQDSIVKQVNENEKAGWKAALNPR 63

Query: 1097 FSNATVAEFKRLLGVKPTPKKLLLGVPVVSHDQSLKLPKSFDARTHWPQCTSIGKILDQG 918
            FSN TV++FKRLLGVKPT K  L G+P+++H + L+LP+ FDAR  W  C++IG+ILDQG
Sbjct:   64 FSNFTVSQFKRLLGVKPTRKGDLKGIPILTHPKLLELPQEFDARVAWSNCSTIGRILDQG 123

Query:  917 HCGSCWAFGAVESLSDRFCIQFGMNITLSVNDLLACCGFRCGDGCDGGYPISAWQYFSYS 738
            HCGSCWAFGAVESLSDRFCI +G+NI+LS NDL ACCGF CGDGCDGGYP+ AW+YF   
Sbjct:  124 HCGSCWAFGAVESLSDRFCIHYGLNISLSANDLYACCGFLCGDGCDGGYPLQAWKYFVRK 183

Query:  737 GVVTEECDPYFDQTGCSHPGCEPAYNTPQCLRKCVGRNQLWSESKHYSINTYVVESNPQD 558
            GVVT+ECDPYFD  GCSHPGCEPAY TP+C RKCV +N LWS SKH+ +N Y++ S+P  
Sbjct:  184 GVVTDECDPYFDNEGCSHPGCEPAYPTPKCHRKCVKQNLLWSRSKHFGVNAYMISSDPHS 243

Query:  557 IMAEIYKNGPVEVSFTVYEDFAHYKSGVYKHITGSNIGGHAVKLIGWGTTDDGEDYWLLA 378
            IM E+YKNGPVEVSFTVYEDFAHYKSGVYKH+TG  +GGHAVKLIGWGT++DGEDYWLLA
Sbjct:  244 IMTEVYKNGPVEVSFTVYEDFAHYKSGVYKHVTGDIMGGHAVKLIGWGTSEDGEDYWLLA 303

Query:  377 NQWNRSWGDDGYFMIRRGTNECGIEDEPVGGLPSTKNV 264
            NQWNR WGDDGYF IRRGTNEC IEDE V GLPS +N+
Sbjct:  304 NQWNRGWGDDGYFKIRRGTNECEIEDEVVAGLPSARNL 341

>tr|B9I982|B9I982_POPTR Predicted protein OS=Populus trichocarpa
        GN=POPTRDRAFT_1098794 PE=3 SV=1

          Length = 339

 Score =  518 bits (1332), Expect = 9e-145
 Identities = 230/327 (70%), Positives = 273/327 (83%)
 Frame = -1

Query: 1220 QGVAAENLTKQKLSSKILQEEIVKKVNEHPNAGWKAAINDRFSNATVAEFKRLLGVKPTP 1041
            Q  A E ++K KL+S+ILQ+ IV+KVNE+P AGW+A +N +FSN +V EFK LLGVK TP
Sbjct:    6 QATAEEPVSKLKLNSRILQDSIVQKVNENPKAGWEATMNPQFSNYSVGEFKYLLGVKQTP 65

Query: 1040 KKLLLGVPVVSHDQSLKLPKSFDARTHWPQCTSIGKILDQGHCGSCWAFGAVESLSDRFC 861
            +K L GVP++ H +S+KLP  FDART WP C++IG+ILDQGHCGSCWAFGAVESLSDRFC
Sbjct:   66 RKELRGVPLLRHPKSMKLPIEFDARTAWPHCSTIGRILDQGHCGSCWAFGAVESLSDRFC 125

Query:  860 IQFGMNITLSVNDLLACCGFRCGDGCDGGYPISAWQYFSYSGVVTEECDPYFDQTGCSHP 681
            I +GMN++LSVNDLLACCG+ CG GCDGG PI AW+YF  SGVVTEECDPYFD  GCSHP
Sbjct:  126 IHYGMNLSLSVNDLLACCGWMCGAGCDGGSPIDAWRYFVQSGVVTEECDPYFDDIGCSHP 185

Query:  680 GCEPAYNTPQCLRKCVGRNQLWSESKHYSINTYVVESNPQDIMAEIYKNGPVEVSFTVYE 501
            GCEP + TP+C RKC  +N+LW+ESKH+S+N Y ++S+P  IMAE+  NGPVEV+FTVYE
Sbjct:  186 GCEPGFPTPKCERKCADKNKLWAESKHFSVNAYRIDSDPHSIMAEVSSNGPVEVAFTVYE 245

Query:  500 DFAHYKSGVYKHITGSNIGGHAVKLIGWGTTDDGEDYWLLANQWNRSWGDDGYFMIRRGT 321
            DFAHYKSGVYKHITG  +GGHAVKLIGWGT++DGEDYWLLANQWNR WGDDGYF I+RGT
Sbjct:  246 DFAHYKSGVYKHITGDAMGGHAVKLIGWGTSEDGEDYWLLANQWNRGWGDDGYFKIKRGT 305

Query:  320 NECGIEDEPVGGLPSTKNVFKVTTGSD 240
            NECGIE   V GLPST+N+ +   G D
Sbjct:  306 NECGIEGAVVAGLPSTRNLVREVAGID 332

>tr|Q2HV10|Q2HV10_MEDTR Peptidase C1A, papain; Somatotropin hormone; Peptidase
        C1, propeptide OS=Medicago truncatula GN=MtrDRAFT_AC149038g2v2 PE=3
        SV=1

          Length = 356

 Score =  515 bits (1326), Expect = 5e-144
 Identities = 229/320 (71%), Positives = 265/320 (82%)
 Frame = -1

Query: 1199 LTKQKLSSKILQEEIVKKVNEHPNAGWKAAINDRFSNATVAEFKRLLGVKPTPKKLLLGV 1020
            L++ KL+S ILQE I +++NE+P AGW+A IN RFSN TV +FKRLLGVK TP+  L   
Sbjct:   30 LSEVKLNSHILQESIARQINENPEAGWEATINPRFSNFTVGQFKRLLGVKQTPRSELSSA 89

Query: 1019 PVVSHDQSLKLPKSFDARTHWPQCTSIGKILDQGHCGSCWAFGAVESLSDRFCIQFGMNI 840
            PVV+H +SLKLPK FDART W QC++IG+ILDQGHCGSCWAFGAVESLSDRFCI F MN+
Sbjct:   90 PVVTHPKSLKLPKDFDARTAWSQCSTIGRILDQGHCGSCWAFGAVESLSDRFCIHFDMNV 149

Query:  839 TLSVNDLLACCGFRCGDGCDGGYPISAWQYFSYSGVVTEECDPYFDQTGCSHPGCEPAYN 660
            +LSVND+LACCG  CG GC GG P SAW Y ++ GVVTEECDPYFDQ GCSHPGCEP Y 
Sbjct:  150 SLSVNDILACCGLLCGAGCAGGTPFSAWIYLAHHGVVTEECDPYFDQIGCSHPGCEPTYR 209

Query:  659 TPQCLRKCVGRNQLWSESKHYSINTYVVESNPQDIMAEIYKNGPVEVSFTVYEDFAHYKS 480
            TP+C++KCV  NQLW  SKHYS+  Y V S+PQDIMAE+YKNGPVEV+FTVYEDFAHYKS
Sbjct:  210 TPKCVKKCVNGNQLWETSKHYSVKAYTVNSDPQDIMAEVYKNGPVEVAFTVYEDFAHYKS 269

Query:  479 GVYKHITGSNIGGHAVKLIGWGTTDDGEDYWLLANQWNRSWGDDGYFMIRRGTNECGIED 300
            GVYKHITG  +GGHAVKL+GWGT+ +GEDYWLLANQWN +WGDDGYF I+RGTNECGIE+
Sbjct:  270 GVYKHITGFALGGHAVKLVGWGTSHEGEDYWLLANQWNTNWGDDGYFKIKRGTNECGIEN 329

Query:  299 EPVGGLPSTKNVFKVTTGSD 240
                GLPSTKN+ +  T  D
Sbjct:  330 AVTAGLPSTKNIVREVTDMD 349

>tr|A2Y316|A2Y316_ORYSI Putative uncharacterized protein OS=Oryza sativa subsp.
        indica GN=OsI_19406 PE=3 SV=1

          Length = 358

 Score =  507 bits (1304), Expect = 2e-141
 Identities = 224/314 (71%), Positives = 262/314 (83%)
 Frame = -1

Query: 1199 LTKQKLSSKILQEEIVKKVNEHPNAGWKAAINDRFSNATVAEFKRLLGVKPTPKKLLLGV 1020
            +TK+  SS+I+Q++I+K +N+HPNAGW AA N  F+N T A+FK +LGVKPTP  +L  V
Sbjct:   32 MTKEGGSSRIIQDDIIKAINKHPNAGWTAARNPYFANYTTAQFKHILGVKPTPHSVLNDV 91

Query: 1019 PVVSHDQSLKLPKSFDARTHWPQCTSIGKILDQGHCGSCWAFGAVESLSDRFCIQFGMNI 840
            PV ++ +SL LPK FDAR+ W QC +IG ILDQGHCGSCWAFGAVE L DRFCI F MNI
Sbjct:   92 PVKTYPRSLMLPKEFDARSAWSQCNTIGTILDQGHCGSCWAFGAVECLQDRFCIHFNMNI 151

Query:  839 TLSVNDLLACCGFRCGDGCDGGYPISAWQYFSYSGVVTEECDPYFDQTGCSHPGCEPAYN 660
            +LSVNDL+ACCGF CGDGCDGGYPI AW+YF  +GVVT+ECDPYFDQ GC HPGCEPAY 
Sbjct:  152 SLSVNDLVACCGFMCGDGCDGGYPIMAWRYFVRNGVVTDECDPYFDQVGCKHPGCEPAYP 211

Query:  659 TPQCLRKCVGRNQLWSESKHYSINTYVVESNPQDIMAEIYKNGPVEVSFTVYEDFAHYKS 480
            TP C +KC  +NQ+W E KH+S+N Y V S+P DIMAE+Y+NGPVEV+FTVYEDFAHYKS
Sbjct:  212 TPVCEKKCKVQNQVWLEKKHFSVNAYRVNSDPHDIMAEVYQNGPVEVAFTVYEDFAHYKS 271

Query:  479 GVYKHITGSNIGGHAVKLIGWGTTDDGEDYWLLANQWNRSWGDDGYFMIRRGTNECGIED 300
            GVYKHITG  +GGHAVKLIGWGTTD GEDYWLLANQWNR WGDDGYF I RGTNECGIE+
Sbjct:  272 GVYKHITGGMMGGHAVKLIGWGTTDAGEDYWLLANQWNRGWGDDGYFKIIRGTNECGIEE 331

Query:  299 EPVGGLPSTKNVFK 258
            + V G+PSTKN+ +
Sbjct:  332 DVVAGMPSTKNMVR 345

>tr|Q5D214|Q5D214_ORYSJ Cathepsin B-like cysteine protease OS=Oryza sativa
        subsp. japonica GN=OsJ_17999 PE=2 SV=1

          Length = 358

 Score =  507 bits (1304), Expect = 2e-141
 Identities = 224/314 (71%), Positives = 262/314 (83%)
 Frame = -1

Query: 1199 LTKQKLSSKILQEEIVKKVNEHPNAGWKAAINDRFSNATVAEFKRLLGVKPTPKKLLLGV 1020
            +TK+  SS+I+Q++I+K +N+HPNAGW AA N  F+N T A+FK +LGVKPTP  +L  V
Sbjct:   32 MTKEGGSSRIIQDDIIKAINKHPNAGWTAARNPYFANYTTAQFKHILGVKPTPHSVLNDV 91

Query: 1019 PVVSHDQSLKLPKSFDARTHWPQCTSIGKILDQGHCGSCWAFGAVESLSDRFCIQFGMNI 840
            PV ++ +SL LPK FDAR+ W QC +IG ILDQGHCGSCWAFGAVE L DRFCI F MNI
Sbjct:   92 PVKTYPRSLMLPKEFDARSAWSQCNTIGTILDQGHCGSCWAFGAVECLQDRFCIHFNMNI 151

Query:  839 TLSVNDLLACCGFRCGDGCDGGYPISAWQYFSYSGVVTEECDPYFDQTGCSHPGCEPAYN 660
            +LSVNDL+ACCGF CGDGCDGGYPI AW+YF  +GVVT+ECDPYFDQ GC HPGCEPAY 
Sbjct:  152 SLSVNDLVACCGFMCGDGCDGGYPIMAWRYFVRNGVVTDECDPYFDQVGCKHPGCEPAYP 211

Query:  659 TPQCLRKCVGRNQLWSESKHYSINTYVVESNPQDIMAEIYKNGPVEVSFTVYEDFAHYKS 480
            TP C +KC  +NQ+W E KH+S+N Y V S+P DIMAE+Y+NGPVEV+FTVYEDFAHYKS
Sbjct:  212 TPVCEKKCKVQNQVWLEKKHFSVNAYRVNSDPHDIMAEVYQNGPVEVAFTVYEDFAHYKS 271

Query:  479 GVYKHITGSNIGGHAVKLIGWGTTDDGEDYWLLANQWNRSWGDDGYFMIRRGTNECGIED 300
            GVYKHITG  +GGHAVKLIGWGTTD GEDYWLLANQWNR WGDDGYF I RGTNECGIE+
Sbjct:  272 GVYKHITGGMMGGHAVKLIGWGTTDAGEDYWLLANQWNRGWGDDGYFKIIRGTNECGIEE 331

Query:  299 EPVGGLPSTKNVFK 258
            + V G+PSTKN+ +
Sbjct:  332 DVVAGMPSTKNMVR 345

>tr|Q6ST24|Q6ST24_SOLTU Cathepsin B-like cysteine proteinase OS=Solanum
        tuberosum PE=2 SV=1

          Length = 354

 Score =  505 bits (1300), Expect = 5e-141
 Identities = 227/322 (70%), Positives = 264/322 (81%)
 Frame = -1

Query: 1229 LDLQGVAAENLTKQKLSSKILQEEIVKKVNEHPNAGWKAAINDRFSNATVAEFKRLLGVK 1050
            L LQ  A + +++ KL S ILQ+ IVK+VNE+  AGWKAA N + SN TV++FKRLLGVK
Sbjct:   20 LILQVAAEKPISEAKLESAILQDSIVKRVNENAEAGWKAAFNPQLSNFTVSQFKRLLGVK 79

Query: 1049 PTPKKLLLGVPVVSHDQSLKLPKSFDARTHWPQCTSIGKILDQGHCGSCWAFGAVESLSD 870
            P  +  L G+PV++H +  +LPK FDAR  WPQC++IGKILDQGHCGSCWAFGAVESLSD
Sbjct:   80 PAREGDLEGIPVLTHPRLKELPKEFDARKAWPQCSTIGKILDQGHCGSCWAFGAVESLSD 139

Query:  869 RFCIQFGMNITLSVNDLLACCGFRCGDGCDGGYPISAWQYFSYSGVVTEECDPYFDQTGC 690
            RFCI + ++I+LSVNDLLACC F CG GCDGGYPI+AW+YF  SGVVTEECDPYFD TGC
Sbjct:  140 RFCIHYNLSISLSVNDLLACCSFLCGSGCDGGYPIAAWRYFKRSGVVTEECDPYFDTTGC 199

Query:  689 SHPGCEPAYNTPQCLRKCVGRNQLWSESKHYSINTYVVESNPQDIMAEIYKNGPVEVSFT 510
            SHPGCEP Y TP+C RKCV  N LW +SKHY +N Y V  +PQ IMAE+YKNGPVEVSFT
Sbjct:  200 SHPGCEPLYPTPKCHRKCVKGNVLWRKSKHYGVNAYRVSHDPQSIMAEVYKNGPVEVSFT 259

Query:  509 VYEDFAHYKSGVYKHITGSNIGGHAVKLIGWGTTDDGEDYWLLANQWNRSWGDDGYFMIR 330
            VYEDFAHYKSGVYKH+TG N+GGHAVKLIGWGT++ GEDYWL+ N WNR WG+DGYF IR
Sbjct:  260 VYEDFAHYKSGVYKHVTGGNMGGHAVKLIGWGTSEQGEDYWLIVNSWNRGWGEDGYFKIR 319

Query:  329 RGTNECGIEDEPVGGLPSTKNV 264
            RGTNECGIE   V GLPS +N+
Sbjct:  320 RGTNECGIEHSVVAGLPSARNL 341

>tr|B4ESF5|B4ESF5_HORVD Papain-like cysteine proteinase OS=Hordeum vulgare var.
        distichum GN=pap-20 PE=2 SV=1

          Length = 355

 Score =  502 bits (1291), Expect = 5e-140
 Identities = 227/339 (66%), Positives = 267/339 (78%), Gaps = 4/339 (1%)
 Frame = -1

Query: 1268 VSVVLLLGLVSSSLDLQGVAAE----NLTKQKLSSKILQEEIVKKVNEHPNAGWKAAIND 1101
            V V L L   ++++ +  VAA        K + S  I+QE+I++ VN+HPNAGW A  N 
Sbjct:    4 VGVSLALLAAAAAVVISAVAAAPQLVGAAKAEHSLGIIQEDIIQTVNDHPNAGWTAGHNP 63

Query: 1100 RFSNATVAEFKRLLGVKPTPKKLLLGVPVVSHDQSLKLPKSFDARTHWPQCTSIGKILDQ 921
             F+N T+ +FK +LGVKPTP  LL GVP+ +H +S  LPK FDART W  C++IG ILDQ
Sbjct:   64 YFANYTIEQFKHILGVKPTPPGLLAGVPIKTHPKSADLPKEFDARTQWSSCSTIGNILDQ 123

Query:  920 GHCGSCWAFGAVESLSDRFCIQFGMNITLSVNDLLACCGFRCGDGCDGGYPISAWQYFSY 741
            GHCG+CWAF AVESL DRFCI   M+++LSVNDLLACCGF CG GC+GGYPISAW+YF  
Sbjct:  124 GHCGACWAFAAVESLQDRFCIHLNMSVSLSVNDLLACCGFLCGSGCNGGYPISAWRYFRR 183

Query:  740 SGVVTEECDPYFDQTGCSHPGCEPAYNTPQCLRKCVGRNQLWSESKHYSINTYVVESNPQ 561
            SGVVTEECDPYFDQTGC HPGCEPAY TP+C RKC   NQ+W ++KH+S+N Y V SNP 
Sbjct:  184 SGVVTEECDPYFDQTGCQHPGCEPAYPTPKCHRKCKVENQVWKKNKHFSVNAYRVHSNPH 243

Query:  560 DIMAEIYKNGPVEVSFTVYEDFAHYKSGVYKHITGSNIGGHAVKLIGWGTTDDGEDYWLL 381
            DIMAE+YKNGPVEV+FTVYEDFAHYKSGVYKHITG  +GGHAVKLIGWGT+D GEDYWLL
Sbjct:  244 DIMAEVYKNGPVEVAFTVYEDFAHYKSGVYKHITGGVMGGHAVKLIGWGTSDAGEDYWLL 303

Query:  380 ANQWNRSWGDDGYFMIRRGTNECGIEDEPVGGLPSTKNV 264
            ANQWNR WGDDGYF I RG NECGIE++   G+PSTKN+
Sbjct:  304 ANQWNRGWGDDGYFKIIRGKNECGIEEDVTAGMPSTKNM 342

  Database: UniProt/TrEMBL
    Posted date:  Sat Aug 07 14:51:12 2010
  Number of letters in database: 3,661,877,547
  Number of sequences in database:  11,397,958

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,081,619,501,380
Number of Sequences: 11397958
Number of Extensions: 1081619501380
Number of Successful Extensions: 411930425
Number of sequences better than 0.0: 0