Library    |     Search    |     Batch query    |     SNP    |     SSR  

GenBank blast output of UN14031


BLASTX 7.6.2

Query= UN14031 /QuerySize=1062
        (1061 letters)

Database: GenBank nr;
          15,229,318 sequences; 5,219,829,378 total letters
                                                                  Score    E
Sequences producing significant alignments:                       (bits) Value

gi|91694371|gb|ABE41833.1| caffeoyl-CoA 3-O-methyltransferase [B...    514   1e-143
gi|15235213|ref|NP_195131.1| putative caffeoyl-CoA O-methyltrans...    509   3e-142
gi|21595512|gb|AAM66108.1| caffeoyl-CoA O-methyltransferase-like...    507   2e-141
gi|74053616|gb|AAZ95245.1| putative caffeoyl-CoA O-methyltransfe...    507   2e-141
gi|57639629|gb|AAW55668.1| caffeoyl CoA 3-O-methyltransferase [B...    471   1e-130
gi|212960493|gb|ACJ38669.1| caffeoyl-CoA O-methyltransferase [Be...    470   2e-130
gi|139538879|gb|ABO77959.1| caffeoyl-CoA 3-O methyltransferase [...    465   6e-129
gi|340548706|gb|AEK52482.1| caffeoyl-CoA 3-O-methyltransferase [...    461   8e-128
gi|47680455|gb|AAT37172.1| caffeoyl-CoA-O-methyltransferase [Bro...    461   1e-127
gi|3023436|sp|Q43095.1|CAMT_POPTM RecName: Full=Caffeoyl-CoA O-m...    460   2e-127
gi|224103619|ref|XP_002313125.1| trans-caffeoyl-coa 3-o-methyltr...    460   3e-127
gi|105671415|gb|ABF74683.1| caffeoyl-CoA-O-methyltransferase [Le...    460   3e-127
gi|46394464|gb|AAS91565.1| caffeoyl-CoA O-methyltransferase [Bro...    459   4e-127
gi|30580324|sp|O04899.1|CAMT5_TOBAC RecName: Full=Caffeoyl-CoA O...    458   7e-127
gi|30580381|sp|Q9SWB8.1|CAMT2_EUCGL RecName: Full=Caffeoyl-CoA O...    458   1e-126
gi|91771911|gb|ABE60812.1| caffeoyl coenzyme A 3-O-methyltransfe...    458   1e-126
gi|2511737|gb|AAB80931.1| caffeoyl-CoA 3-O-methyltransferase 5 [...    457   2e-126
gi|55724835|gb|AAT75320.2| caffeoyl-CoA 3-O-methyltransferase [B...    457   2e-126
gi|118484246|gb|ABK94003.1| unknown [Populus trichocarpa]              457   2e-126
gi|167613943|gb|ABZ89569.1| O-methyltransferase 5 [Humulus lupulus]    457   2e-126

>gi|91694371|gb|ABE41833.1| caffeoyl-CoA 3-O-methyltransferase [Brassica rapa
        subsp. pekinensis]

          Length = 258

 Score =  514 bits (1323), Expect = 1e-143
 Identities = 255/258 (98%), Positives = 256/258 (99%)
 Frame = +2

Query:  59 MATTTAEATKTSTNNGEDKQSQNLRHQEVGHKSLLQSDDLYQYILETSVYPREPESMKEL 238
           MATTTAEATKTS+ N EDKQSQNLRHQEVGHKSLLQSDDLYQYILETSVYPREPESMKEL
Sbjct:   1 MATTTAEATKTSSTNVEDKQSQNLRHQEVGHKSLLQSDDLYQYILETSVYPREPESMKEL 60

Query: 239 REVTAKHPWNIMTTSADEGQFLNMLIKLVNAKNTMEIGVYTGYSLLATALALPEDGKILA 418
           REVTAKHPWNIMTTSADEGQFLNMLIKLVNAKNTMEIGVYTGYSLLATALALPEDGKILA
Sbjct:  61 REVTAKHPWNIMTTSADEGQFLNMLIKLVNAKNTMEIGVYTGYSLLATALALPEDGKILA 120

Query: 419 MDVNRENYELGLPIIEKAGVAHKIDFREGPALPVLDQLVADEKNHGTYDFIFVDADKDNY 598
           MDVNRENYELGLPIIEKAGVAHKIDFREGPALPVLDQLVADEKNHGTYDFIFVDADKDNY
Sbjct: 121 MDVNRENYELGLPIIEKAGVAHKIDFREGPALPVLDQLVADEKNHGTYDFIFVDADKDNY 180

Query: 599 INYHKRLIDLVKVGGVIGYDNTLWNGSVVAPPDAPMRKYVRYYRDFVLELNKALAADPRI 778
           INYHKRLIDLVKVGGVIGYDNTLWNGSVVAPPDAPMRKYVRYYRDFVLELNKALAADPRI
Sbjct: 181 INYHKRLIDLVKVGGVIGYDNTLWNGSVVAPPDAPMRKYVRYYRDFVLELNKALAADPRI 240

Query: 779 EICMLPVGDGITICRRIS 832
           EICMLPVGDGITICRRIS
Sbjct: 241 EICMLPVGDGITICRRIS 258

>gi|15235213|ref|NP_195131.1| putative caffeoyl-CoA O-methyltransferase
        [Arabidopsis thaliana]

          Length = 259

 Score =  509 bits (1310), Expect = 3e-142
 Identities = 252/259 (97%), Positives = 256/259 (98%), Gaps = 1/259 (0%)
 Frame = +2

Query:  59 MATTTAEATKTSTNNGED-KQSQNLRHQEVGHKSLLQSDDLYQYILETSVYPREPESMKE 235
           MATTT EATKTS+ NGED KQSQNLRHQEVGHKSLLQSDDLYQYILETSVYPREPESMKE
Sbjct:   1 MATTTTEATKTSSTNGEDQKQSQNLRHQEVGHKSLLQSDDLYQYILETSVYPREPESMKE 60

Query: 236 LREVTAKHPWNIMTTSADEGQFLNMLIKLVNAKNTMEIGVYTGYSLLATALALPEDGKIL 415
           LREVTAKHPWNIMTTSADEGQFLNMLIKLVNAKNTMEIGVYTGYSLLATALALPEDGKIL
Sbjct:  61 LREVTAKHPWNIMTTSADEGQFLNMLIKLVNAKNTMEIGVYTGYSLLATALALPEDGKIL 120

Query: 416 AMDVNRENYELGLPIIEKAGVAHKIDFREGPALPVLDQLVADEKNHGTYDFIFVDADKDN 595
           AMDVNRENYELGLPIIEKAGVAHKIDFREGPALPVLD++VADEKNHGTYDFIFVDADKDN
Sbjct: 121 AMDVNRENYELGLPIIEKAGVAHKIDFREGPALPVLDEIVADEKNHGTYDFIFVDADKDN 180

Query: 596 YINYHKRLIDLVKVGGVIGYDNTLWNGSVVAPPDAPMRKYVRYYRDFVLELNKALAADPR 775
           YINYHKRLIDLVK+GGVIGYDNTLWNGSVVAPPDAPMRKYVRYYRDFVLELNKALAADPR
Sbjct: 181 YINYHKRLIDLVKIGGVIGYDNTLWNGSVVAPPDAPMRKYVRYYRDFVLELNKALAADPR 240

Query: 776 IEICMLPVGDGITICRRIS 832
           IEICMLPVGDGITICRRIS
Sbjct: 241 IEICMLPVGDGITICRRIS 259

>gi|21595512|gb|AAM66108.1| caffeoyl-CoA O-methyltransferase-like protein
        [Arabidopsis thaliana]

          Length = 259

 Score =  507 bits (1303), Expect = 2e-141
 Identities = 251/259 (96%), Positives = 255/259 (98%), Gaps = 1/259 (0%)
 Frame = +2

Query:  59 MATTTAEATKTSTNNGED-KQSQNLRHQEVGHKSLLQSDDLYQYILETSVYPREPESMKE 235
           MATTT EATKTS+ NGED KQSQNLRHQEVGHKSLLQSDDLYQYILETSVYPREPESMKE
Sbjct:   1 MATTTTEATKTSSTNGEDQKQSQNLRHQEVGHKSLLQSDDLYQYILETSVYPREPESMKE 60

Query: 236 LREVTAKHPWNIMTTSADEGQFLNMLIKLVNAKNTMEIGVYTGYSLLATALALPEDGKIL 415
           LREVTAKHPWNIMTTSADEGQFLNMLIKLVNAKNTMEIGVYTGYSLLATALALPEDGKIL
Sbjct:  61 LREVTAKHPWNIMTTSADEGQFLNMLIKLVNAKNTMEIGVYTGYSLLATALALPEDGKIL 120

Query: 416 AMDVNRENYELGLPIIEKAGVAHKIDFREGPALPVLDQLVADEKNHGTYDFIFVDADKDN 595
           AMDVNRENYELGLPIIEKAGVAHKIDFREGPALPVLD++VADEKNHGTYDFIFVDADKD 
Sbjct: 121 AMDVNRENYELGLPIIEKAGVAHKIDFREGPALPVLDEIVADEKNHGTYDFIFVDADKDX 180

Query: 596 YINYHKRLIDLVKVGGVIGYDNTLWNGSVVAPPDAPMRKYVRYYRDFVLELNKALAADPR 775
           YINYHKRLIDLVK+GGVIGYDNTLWNGSVVAPPDAPMRKYVRYYRDFVLELNKALAADPR
Sbjct: 181 YINYHKRLIDLVKIGGVIGYDNTLWNGSVVAPPDAPMRKYVRYYRDFVLELNKALAADPR 240

Query: 776 IEICMLPVGDGITICRRIS 832
           IEICMLPVGDGITICRRIS
Sbjct: 241 IEICMLPVGDGITICRRIS 259

>gi|74053616|gb|AAZ95245.1| putative caffeoyl-CoA O-methyltransferase protein
        [Isatis tinctoria]

          Length = 257

 Score =  507 bits (1303), Expect = 2e-141
 Identities = 252/257 (98%), Positives = 254/257 (98%), Gaps = 1/257 (0%)
 Frame = +2

Query:  62 ATTTAEATKTSTNNGEDKQSQNLRHQEVGHKSLLQSDDLYQYILETSVYPREPESMKELR 241
           ATTT EATKTST NGEDKQSQNLRHQEVGHKSLLQSDDLYQYILETSVYPREPESMKELR
Sbjct:   2 ATTTTEATKTST-NGEDKQSQNLRHQEVGHKSLLQSDDLYQYILETSVYPREPESMKELR 60

Query: 242 EVTAKHPWNIMTTSADEGQFLNMLIKLVNAKNTMEIGVYTGYSLLATALALPEDGKILAM 421
           EVTAKHPWNIMTTSADEGQFLNMLIKL+NAKNTMEIGVYTGYSLLATALALPEDGKILAM
Sbjct:  61 EVTAKHPWNIMTTSADEGQFLNMLIKLINAKNTMEIGVYTGYSLLATALALPEDGKILAM 120

Query: 422 DVNRENYELGLPIIEKAGVAHKIDFREGPALPVLDQLVADEKNHGTYDFIFVDADKDNYI 601
           DVNRENYELGLPIIEKAGVAHKIDFREGPALPVLDQLVADEKNHGTYDFIFVDADKDNYI
Sbjct: 121 DVNRENYELGLPIIEKAGVAHKIDFREGPALPVLDQLVADEKNHGTYDFIFVDADKDNYI 180

Query: 602 NYHKRLIDLVKVGGVIGYDNTLWNGSVVAPPDAPMRKYVRYYRDFVLELNKALAADPRIE 781
           NYHKRLIDLVKVGGVIGYDNTLWNGSVVA PDAPMRKYVRYYRDFVLELNKALAADPRIE
Sbjct: 181 NYHKRLIDLVKVGGVIGYDNTLWNGSVVAAPDAPMRKYVRYYRDFVLELNKALAADPRIE 240

Query: 782 ICMLPVGDGITICRRIS 832
           ICMLPVGDGITICRRI+
Sbjct: 241 ICMLPVGDGITICRRIN 257

>gi|57639629|gb|AAW55668.1| caffeoyl CoA 3-O-methyltransferase [Betula
        platyphylla]

          Length = 247

 Score =  471 bits (1211), Expect = 1e-130
 Identities = 226/243 (93%), Positives = 238/243 (97%)
 Frame = +2

Query: 101 NGEDKQSQNLRHQEVGHKSLLQSDDLYQYILETSVYPREPESMKELREVTAKHPWNIMTT 280
           NGED Q+Q  RHQEVGHKSLLQSD LYQYILETSVYP+EPE MKELREVTAKHPWNIMTT
Sbjct:   4 NGEDNQNQVSRHQEVGHKSLLQSDALYQYILETSVYPKEPEPMKELREVTAKHPWNIMTT 63

Query: 281 SADEGQFLNMLIKLVNAKNTMEIGVYTGYSLLATALALPEDGKILAMDVNRENYELGLPI 460
           SADEGQFLNML+KL+NAKNTMEIGVYTGYSLLATALALP+DGKILAMD+NRENYELGLP+
Sbjct:  64 SADEGQFLNMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPV 123

Query: 461 IEKAGVAHKIDFREGPALPVLDQLVADEKNHGTYDFIFVDADKDNYINYHKRLIDLVKVG 640
           IEKAGVAHKIDFREGPALP+LDQL+ADEKNHG+YDFIFVDADKDNYINYHKRLIDLVKVG
Sbjct: 124 IEKAGVAHKIDFREGPALPLLDQLIADEKNHGSYDFIFVDADKDNYINYHKRLIDLVKVG 183

Query: 641 GVIGYDNTLWNGSVVAPPDAPMRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITIC 820
           GVIGYDNTLWNGSVVAPPDAP+RKYVRYYRDFVLELNKALAADPRIEICMLPVGDGIT+C
Sbjct: 184 GVIGYDNTLWNGSVVAPPDAPLRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITLC 243

Query: 821 RRI 829
           RRI
Sbjct: 244 RRI 246

>gi|212960493|gb|ACJ38669.1| caffeoyl-CoA O-methyltransferase [Betula
        luminifera]

          Length = 247

 Score =  470 bits (1209), Expect = 2e-130
 Identities = 225/243 (92%), Positives = 238/243 (97%)
 Frame = +2

Query: 101 NGEDKQSQNLRHQEVGHKSLLQSDDLYQYILETSVYPREPESMKELREVTAKHPWNIMTT 280
           NGED Q+Q  RHQEVGHKSLLQSD LYQYILETSVYP+EPESMKELREVTAKHPWNIMTT
Sbjct:   4 NGEDNQNQASRHQEVGHKSLLQSDALYQYILETSVYPKEPESMKELREVTAKHPWNIMTT 63

Query: 281 SADEGQFLNMLIKLVNAKNTMEIGVYTGYSLLATALALPEDGKILAMDVNRENYELGLPI 460
           SADEGQFLNML+KL+NAKNTMEIGVYTGYSLLATALALP+DGKILAMD+NRENYELGLP+
Sbjct:  64 SADEGQFLNMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPV 123

Query: 461 IEKAGVAHKIDFREGPALPVLDQLVADEKNHGTYDFIFVDADKDNYINYHKRLIDLVKVG 640
           IEKAGVAHKIDFREGPALP+LD L+ADEKNHG+YDFIFVDADKDNYINYHKRLIDLVKVG
Sbjct: 124 IEKAGVAHKIDFREGPALPLLDHLIADEKNHGSYDFIFVDADKDNYINYHKRLIDLVKVG 183

Query: 641 GVIGYDNTLWNGSVVAPPDAPMRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITIC 820
           G+IGYDNTLWNGSVVAPPDAP+RKYVRYYRDFVLELNKALAADPRIEICMLPVGDGIT+C
Sbjct: 184 GLIGYDNTLWNGSVVAPPDAPLRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITLC 243

Query: 821 RRI 829
           RRI
Sbjct: 244 RRI 246

>gi|139538879|gb|ABO77959.1| caffeoyl-CoA 3-O methyltransferase [Coffea
        canephora]

          Length = 247

 Score =  465 bits (1196), Expect = 6e-129
 Identities = 220/244 (90%), Positives = 238/244 (97%)
 Frame = +2

Query: 101 NGEDKQSQNLRHQEVGHKSLLQSDDLYQYILETSVYPREPESMKELREVTAKHPWNIMTT 280
           NGE K SQNLRHQEVGHKSLLQSD LYQYILETSVYPREPE MKELRE+TAKHPWNIMTT
Sbjct:   4 NGEGKDSQNLRHQEVGHKSLLQSDALYQYILETSVYPREPEPMKELRELTAKHPWNIMTT 63

Query: 281 SADEGQFLNMLIKLVNAKNTMEIGVYTGYSLLATALALPEDGKILAMDVNRENYELGLPI 460
           SADEGQFLNM+IKL+NAK TMEIGVYTGYSLLATALALPEDGKILAMD+NRENYELGLP+
Sbjct:  64 SADEGQFLNMIIKLINAKKTMEIGVYTGYSLLATALALPEDGKILAMDINRENYELGLPV 123

Query: 461 IEKAGVAHKIDFREGPALPVLDQLVADEKNHGTYDFIFVDADKDNYINYHKRLIDLVKVG 640
           IE+AGV+HKIDFREGPALPVLD+L+ D+KNHG++DFIFVDADKDNY+NYHKR+I+LVKVG
Sbjct: 124 IERAGVSHKIDFREGPALPVLDELIEDDKNHGSFDFIFVDADKDNYLNYHKRIIELVKVG 183

Query: 641 GVIGYDNTLWNGSVVAPPDAPMRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITIC 820
           G+IGYDNTLWNGSVVAPPDAPMRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGIT+C
Sbjct: 184 GMIGYDNTLWNGSVVAPPDAPMRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITLC 243

Query: 821 RRIS 832
           RR+S
Sbjct: 244 RRVS 247

>gi|340548706|gb|AEK52482.1| caffeoyl-CoA 3-O-methyltransferase [Dimocarpus
        longan]

          Length = 247

 Score =  461 bits (1186), Expect = 8e-128
 Identities = 218/244 (89%), Positives = 238/244 (97%)
 Frame = +2

Query:  98 NNGEDKQSQNLRHQEVGHKSLLQSDDLYQYILETSVYPREPESMKELREVTAKHPWNIMT 277
           NNGE +Q+Q  RHQEVGHKSLLQSDDLYQYILETSVYP EPESMKELRE+TAKHPWNIMT
Sbjct:   3 NNGESQQNQVGRHQEVGHKSLLQSDDLYQYILETSVYPTEPESMKELRELTAKHPWNIMT 62

Query: 278 TSADEGQFLNMLIKLVNAKNTMEIGVYTGYSLLATALALPEDGKILAMDVNRENYELGLP 457
           TSADEGQFL+ML+KL+NAKNTMEIGVYTGYSLLATALALPEDGKILAMD+NRENYELGLP
Sbjct:  63 TSADEGQFLSMLLKLINAKNTMEIGVYTGYSLLATALALPEDGKILAMDINRENYELGLP 122

Query: 458 IIEKAGVAHKIDFREGPALPVLDQLVADEKNHGTYDFIFVDADKDNYINYHKRLIDLVKV 637
           +I+KAGVAHKIDFREGPA+P+LDQL+ DEKNHG++DFIFVDADKDNY+NYHKRLI+LVKV
Sbjct: 123 VIQKAGVAHKIDFREGPAMPLLDQLIEDEKNHGSFDFIFVDADKDNYLNYHKRLIELVKV 182

Query: 638 GGVIGYDNTLWNGSVVAPPDAPMRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITI 817
           GGVIGYDNTLWNG+VVAPPDAP+RKYVRYYRDFVLELNKAL ADPRIEICMLPVGDG+T+
Sbjct: 183 GGVIGYDNTLWNGTVVAPPDAPLRKYVRYYRDFVLELNKALPADPRIEICMLPVGDGVTL 242

Query: 818 CRRI 829
           CRRI
Sbjct: 243 CRRI 246

>gi|47680455|gb|AAT37172.1| caffeoyl-CoA-O-methyltransferase [Broussonetia
        papyrifera]

          Length = 247

 Score =  461 bits (1184), Expect = 1e-127
 Identities = 219/244 (89%), Positives = 237/244 (97%)
 Frame = +2

Query: 101 NGEDKQSQNLRHQEVGHKSLLQSDDLYQYILETSVYPREPESMKELREVTAKHPWNIMTT 280
           NGE KQ++  RHQEVGHKSLLQSD LYQYILETSVYPREPE+MKELRE+TAKHPWNIMTT
Sbjct:   4 NGEGKQNEAGRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREITAKHPWNIMTT 63

Query: 281 SADEGQFLNMLIKLVNAKNTMEIGVYTGYSLLATALALPEDGKILAMDVNRENYELGLPI 460
           SADEGQFLNML+KL+NAKNTMEIGVYTGYSLLATALALP+DGKILAMD+NRENYELGLP+
Sbjct:  64 SADEGQFLNMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPV 123

Query: 461 IEKAGVAHKIDFREGPALPVLDQLVADEKNHGTYDFIFVDADKDNYINYHKRLIDLVKVG 640
           IEKAGVAHKIDFREGPALPVLDQ++ D K HG++DFIFVDADKDNY+NYHKRLI+LVKVG
Sbjct: 124 IEKAGVAHKIDFREGPALPVLDQMIEDGKYHGSFDFIFVDADKDNYLNYHKRLIELVKVG 183

Query: 641 GVIGYDNTLWNGSVVAPPDAPMRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITIC 820
           GVIGYDNTLWNGSVVAPPDAP+RKYVRYYRDFVLELNKALAADPRIEICMLPVGDGIT+C
Sbjct: 184 GVIGYDNTLWNGSVVAPPDAPLRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITVC 243

Query: 821 RRIS 832
           RR+S
Sbjct: 244 RRVS 247

>gi|3023436|sp|Q43095.1|CAMT_POPTM RecName: Full=Caffeoyl-CoA
        O-methyltransferase; AltName: Full=Trans-caffeoyl-CoA
        3-O-methyltransferase; Short=CCoAMT; Short=CCoAOMT

          Length = 247

 Score =  460 bits (1182), Expect = 2e-127
 Identities = 221/243 (90%), Positives = 236/243 (97%)
 Frame = +2

Query: 101 NGEDKQSQNLRHQEVGHKSLLQSDDLYQYILETSVYPREPESMKELREVTAKHPWNIMTT 280
           NGE++QSQ  RHQEVGHKSLLQSD LYQYILETSVYPREPE MKELREVTAKHPWNIMTT
Sbjct:   4 NGEEQQSQAGRHQEVGHKSLLQSDALYQYILETSVYPREPECMKELREVTAKHPWNIMTT 63

Query: 281 SADEGQFLNMLIKLVNAKNTMEIGVYTGYSLLATALALPEDGKILAMDVNRENYELGLPI 460
           SADEGQFLNML+KLVNAKNTMEIGVYTGYSLLATALA+PEDGKILAMD+NRENYELGLP+
Sbjct:  64 SADEGQFLNMLLKLVNAKNTMEIGVYTGYSLLATALAIPEDGKILAMDINRENYELGLPV 123

Query: 461 IEKAGVAHKIDFREGPALPVLDQLVADEKNHGTYDFIFVDADKDNYINYHKRLIDLVKVG 640
           I+KAGVAHKIDF+EGPALPVLDQ++ D K HG++DFIFVDADKDNYINYHKRLI+LVKVG
Sbjct: 124 IQKAGVAHKIDFKEGPALPVLDQMIEDGKYHGSFDFIFVDADKDNYINYHKRLIELVKVG 183

Query: 641 GVIGYDNTLWNGSVVAPPDAPMRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITIC 820
           G+IGYDNTLWNGSVVAPPDAPMRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGIT+C
Sbjct: 184 GLIGYDNTLWNGSVVAPPDAPMRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITLC 243

Query: 821 RRI 829
           RRI
Sbjct: 244 RRI 246

>gi|224103619|ref|XP_002313125.1| trans-caffeoyl-coa 3-o-methyltransferase
        [Populus trichocarpa]

          Length = 247

 Score =  460 bits (1181), Expect = 3e-127
 Identities = 221/243 (90%), Positives = 236/243 (97%)
 Frame = +2

Query: 101 NGEDKQSQNLRHQEVGHKSLLQSDDLYQYILETSVYPREPESMKELREVTAKHPWNIMTT 280
           NGE++QSQ  RHQEVGHKSLLQSD LYQYILETSVYPREPE MKELREVTAKHPWNIMTT
Sbjct:   4 NGEEQQSQAGRHQEVGHKSLLQSDALYQYILETSVYPREPECMKELREVTAKHPWNIMTT 63

Query: 281 SADEGQFLNMLIKLVNAKNTMEIGVYTGYSLLATALALPEDGKILAMDVNRENYELGLPI 460
           SADEGQFLNML+KLVNAKNTMEIGVYTGYSLLATALA+PEDGKILAMD+NRENYELGLP+
Sbjct:  64 SADEGQFLNMLLKLVNAKNTMEIGVYTGYSLLATALAIPEDGKILAMDINRENYELGLPV 123

Query: 461 IEKAGVAHKIDFREGPALPVLDQLVADEKNHGTYDFIFVDADKDNYINYHKRLIDLVKVG 640
           I+KAGVAHKIDF+EGPALPVLDQ++ D K HG++DFIFVDADKDNYINYHKRLI+LVKVG
Sbjct: 124 IQKAGVAHKIDFKEGPALPVLDQMIEDGKCHGSFDFIFVDADKDNYINYHKRLIELVKVG 183

Query: 641 GVIGYDNTLWNGSVVAPPDAPMRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITIC 820
           G+IGYDNTLWNGSVVAPPDAPMRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGIT+C
Sbjct: 184 GLIGYDNTLWNGSVVAPPDAPMRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITLC 243

Query: 821 RRI 829
           RRI
Sbjct: 244 RRI 246

>gi|105671415|gb|ABF74683.1| caffeoyl-CoA-O-methyltransferase [Leucaena
        leucocephala]

          Length = 244

 Score =  460 bits (1181), Expect = 3e-127
 Identities = 220/242 (90%), Positives = 234/242 (96%)
 Frame = +2

Query: 107 EDKQSQNLRHQEVGHKSLLQSDDLYQYILETSVYPREPESMKELREVTAKHPWNIMTTSA 286
           +  QS+  RHQEVGHKSLLQSD LYQYILETSVYPREPE MKELRE+TAKHPWNIMTTSA
Sbjct:   3 DQNQSEAGRHQEVGHKSLLQSDALYQYILETSVYPREPEPMKELREITAKHPWNIMTTSA 62

Query: 287 DEGQFLNMLIKLVNAKNTMEIGVYTGYSLLATALALPEDGKILAMDVNRENYELGLPIIE 466
           DEGQFLNML+KL+NAKNTMEIGVYTGYSLLATALALPEDGKILAMD+NRENYELGLP+I+
Sbjct:  63 DEGQFLNMLLKLINAKNTMEIGVYTGYSLLATALALPEDGKILAMDINRENYELGLPVIQ 122

Query: 467 KAGVAHKIDFREGPALPVLDQLVADEKNHGTYDFIFVDADKDNYINYHKRLIDLVKVGGV 646
           KAGVAHKI+FREGPALPVLD+LV DEKNHG+YDFIFVDADKDNY+NYHKRLIDLVKVGGV
Sbjct: 123 KAGVAHKIEFREGPALPVLDELVKDEKNHGSYDFIFVDADKDNYLNYHKRLIDLVKVGGV 182

Query: 647 IGYDNTLWNGSVVAPPDAPMRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITICRR 826
           IGYDNTLWNGSVVAPPDAP+RKYVRYYRDFVLELNKALA DPRIEICMLPVGDGIT+CRR
Sbjct: 183 IGYDNTLWNGSVVAPPDAPLRKYVRYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRR 242

Query: 827 IS 832
           IS
Sbjct: 243 IS 244

>gi|46394464|gb|AAS91565.1| caffeoyl-CoA O-methyltransferase [Broussonetia
        papyrifera]

          Length = 247

 Score =  459 bits (1180), Expect = 4e-127
 Identities = 218/244 (89%), Positives = 236/244 (96%)
 Frame = +2

Query: 101 NGEDKQSQNLRHQEVGHKSLLQSDDLYQYILETSVYPREPESMKELREVTAKHPWNIMTT 280
           NGE KQ++  RHQEVGHKSLLQSD LYQYILETSVYPREPE+MKELRE+TAKHPWNIMTT
Sbjct:   4 NGEGKQNEAGRHQEVGHKSLLQSDALYQYILETSVYPREPEAMKELREITAKHPWNIMTT 63

Query: 281 SADEGQFLNMLIKLVNAKNTMEIGVYTGYSLLATALALPEDGKILAMDVNRENYELGLPI 460
           SADEGQFLNML+KL+NAKNTMEIGVYTGYSLLAT LALP+DGKILAMD+NRENYELGLP+
Sbjct:  64 SADEGQFLNMLLKLINAKNTMEIGVYTGYSLLATGLALPDDGKILAMDINRENYELGLPV 123

Query: 461 IEKAGVAHKIDFREGPALPVLDQLVADEKNHGTYDFIFVDADKDNYINYHKRLIDLVKVG 640
           IEKAGVAHKIDFREGPALPVLDQ++ D K HG++DFIFVDADKDNY+NYHKRLI+LVKVG
Sbjct: 124 IEKAGVAHKIDFREGPALPVLDQMIEDGKYHGSFDFIFVDADKDNYLNYHKRLIELVKVG 183

Query: 641 GVIGYDNTLWNGSVVAPPDAPMRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITIC 820
           GVIGYDNTLWNGSVVAPPDAP+RKYVRYYRDFVLELNKALAADPRIEICMLPVGDGIT+C
Sbjct: 184 GVIGYDNTLWNGSVVAPPDAPLRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITVC 243

Query: 821 RRIS 832
           RR+S
Sbjct: 244 RRVS 247

>gi|30580324|sp|O04899.1|CAMT5_TOBAC RecName: Full=Caffeoyl-CoA
        O-methyltransferase 5; AltName: Full=Trans-caffeoyl-CoA
        3-O-methyltransferase 5; Short=CCoAMT-5; Short=CCoAOMT-5

          Length = 240

 Score =  458 bits (1178), Expect = 7e-127
 Identities = 218/235 (92%), Positives = 233/235 (99%)
 Frame = +2

Query: 128 LRHQEVGHKSLLQSDDLYQYILETSVYPREPESMKELREVTAKHPWNIMTTSADEGQFLN 307
           ++HQEVGHKSLLQSD LYQYILETSVYPREPESMKELREVTAKHPWN+MTTSADEGQFLN
Sbjct:   6 IKHQEVGHKSLLQSDALYQYILETSVYPREPESMKELREVTAKHPWNLMTTSADEGQFLN 65

Query: 308 MLIKLVNAKNTMEIGVYTGYSLLATALALPEDGKILAMDVNRENYELGLPIIEKAGVAHK 487
           ML+KL+NAKNTMEIGVYTGYSLLATALA+P+DGKILAMD+NRENYE+GLPIIEKAGVAHK
Sbjct:  66 MLLKLINAKNTMEIGVYTGYSLLATALAIPDDGKILAMDINRENYEIGLPIIEKAGVAHK 125

Query: 488 IDFREGPALPVLDQLVADEKNHGTYDFIFVDADKDNYINYHKRLIDLVKVGGVIGYDNTL 667
           I+FREGPALPVLDQLV D+KNHGTYDFIFVDADKDNYINYHKR+IDLVKVGG+IGYDNTL
Sbjct: 126 IEFREGPALPVLDQLVEDKKNHGTYDFIFVDADKDNYINYHKRIIDLVKVGGLIGYDNTL 185

Query: 668 WNGSVVAPPDAPMRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITICRRIS 832
           WNGSVVAPPDAPMRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGIT+CRRI+
Sbjct: 186 WNGSVVAPPDAPMRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITLCRRIT 240

>gi|30580381|sp|Q9SWB8.1|CAMT2_EUCGL RecName: Full=Caffeoyl-CoA
        O-methyltransferase 2; AltName: Full=Trans-caffeoyl-CoA
        3-O-methyltransferase 2; Short=CCoAMT-2; Short=CCoAOMT-2

          Length = 247

 Score =  458 bits (1176), Expect = 1e-126
 Identities = 216/244 (88%), Positives = 235/244 (96%)
 Frame = +2

Query: 101 NGEDKQSQNLRHQEVGHKSLLQSDDLYQYILETSVYPREPESMKELREVTAKHPWNIMTT 280
           N E +Q+Q  +H EVGHKSLLQSD LYQYILETSVYPREPESMKELRE+TAKHPWN+MTT
Sbjct:   4 NAEPQQTQPAKHSEVGHKSLLQSDALYQYILETSVYPREPESMKELREITAKHPWNLMTT 63

Query: 281 SADEGQFLNMLIKLVNAKNTMEIGVYTGYSLLATALALPEDGKILAMDVNRENYELGLPI 460
           SADEGQFLNML+KL+NAKNTMEIGVYTGYSLLATALALP+DGKILAMD+NREN+E+GLP+
Sbjct:  64 SADEGQFLNMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENFEIGLPV 123

Query: 461 IEKAGVAHKIDFREGPALPVLDQLVADEKNHGTYDFIFVDADKDNYINYHKRLIDLVKVG 640
           IEKAG+AHKIDFREGPALP+LDQLV DEKNHGTYDFIFVDADKDNYINYHKRLIDLVKVG
Sbjct: 124 IEKAGLAHKIDFREGPALPLLDQLVQDEKNHGTYDFIFVDADKDNYINYHKRLIDLVKVG 183

Query: 641 GVIGYDNTLWNGSVVAPPDAPMRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITIC 820
           G+IGYDNTLWNGSVVAP DAP+RKYVRYYRDFVLELNKALA DPR+EICMLPVGDGIT+C
Sbjct: 184 GLIGYDNTLWNGSVVAPADAPLRKYVRYYRDFVLELNKALAVDPRVEICMLPVGDGITLC 243

Query: 821 RRIS 832
           RR+S
Sbjct: 244 RRVS 247

>gi|91771911|gb|ABE60812.1| caffeoyl coenzyme A 3-O-methyltransferase 2
        [Leucaena leucocephala]

          Length = 244

 Score =  458 bits (1176), Expect = 1e-126
 Identities = 218/242 (90%), Positives = 234/242 (96%)
 Frame = +2

Query: 107 EDKQSQNLRHQEVGHKSLLQSDDLYQYILETSVYPREPESMKELREVTAKHPWNIMTTSA 286
           +  QS+  RHQEVGHKSLLQSD LYQYILETSVYPREPE MKE+RE+TAKHPWNIMTTSA
Sbjct:   3 DQNQSEAGRHQEVGHKSLLQSDALYQYILETSVYPREPEPMKEIREITAKHPWNIMTTSA 62

Query: 287 DEGQFLNMLIKLVNAKNTMEIGVYTGYSLLATALALPEDGKILAMDVNRENYELGLPIIE 466
           DEGQFLNML+KL+NAKNTMEIGVYTGYSLLATALALPEDGKILAMD+NRENYELGLP+I+
Sbjct:  63 DEGQFLNMLLKLINAKNTMEIGVYTGYSLLATALALPEDGKILAMDINRENYELGLPVIQ 122

Query: 467 KAGVAHKIDFREGPALPVLDQLVADEKNHGTYDFIFVDADKDNYINYHKRLIDLVKVGGV 646
           KAGVAHKI+F+EGPALPVLD+LV DEKNHG+YDFIFVDADKDNY+NYHKRLIDLVKVGGV
Sbjct: 123 KAGVAHKIEFKEGPALPVLDELVKDEKNHGSYDFIFVDADKDNYLNYHKRLIDLVKVGGV 182

Query: 647 IGYDNTLWNGSVVAPPDAPMRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITICRR 826
           IGYDNTLWNGSVVAPPDAP+RKYVRYYRDFVLELNKALA DPRIEICMLPVGDGIT+CRR
Sbjct: 183 IGYDNTLWNGSVVAPPDAPLRKYVRYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRR 242

Query: 827 IS 832
           IS
Sbjct: 243 IS 244

>gi|2511737|gb|AAB80931.1| caffeoyl-CoA 3-O-methyltransferase 5 [Nicotiana
        tabacum]

          Length = 240

 Score =  457 bits (1174), Expect = 2e-126
 Identities = 217/235 (92%), Positives = 232/235 (98%)
 Frame = +2

Query: 128 LRHQEVGHKSLLQSDDLYQYILETSVYPREPESMKELREVTAKHPWNIMTTSADEGQFLN 307
           ++HQEVGHKSLLQSD LYQYILETSVYPREPESMKELREVTAKHPWN+MTTSADEGQFLN
Sbjct:   6 IKHQEVGHKSLLQSDALYQYILETSVYPREPESMKELREVTAKHPWNLMTTSADEGQFLN 65

Query: 308 MLIKLVNAKNTMEIGVYTGYSLLATALALPEDGKILAMDVNRENYELGLPIIEKAGVAHK 487
           ML+KL+NAKNTMEIGVYTGYSLLATALA+P+DGKILAMD+NRENYE+GLPIIEKAGVAHK
Sbjct:  66 MLLKLINAKNTMEIGVYTGYSLLATALAIPDDGKILAMDINRENYEIGLPIIEKAGVAHK 125

Query: 488 IDFREGPALPVLDQLVADEKNHGTYDFIFVDADKDNYINYHKRLIDLVKVGGVIGYDNTL 667
           I+FREGPALPVLDQLV D+KNHGTYDFIFVDADKDNYINYHKR+IDLVKVGG+IGYDNTL
Sbjct: 126 IEFREGPALPVLDQLVEDKKNHGTYDFIFVDADKDNYINYHKRIIDLVKVGGLIGYDNTL 185

Query: 668 WNGSVVAPPDAPMRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITICRRIS 832
           WNGSVVAPPDAPMRKYVRYYRDFVLELNKALA DPRIEICMLPVGDGIT+CRRI+
Sbjct: 186 WNGSVVAPPDAPMRKYVRYYRDFVLELNKALAVDPRIEICMLPVGDGITLCRRIT 240

>gi|55724835|gb|AAT75320.2| caffeoyl-CoA 3-O-methyltransferase [Boehmeria
        nivea]

          Length = 247

 Score =  457 bits (1174), Expect = 2e-126
 Identities = 217/245 (88%), Positives = 236/245 (96%)
 Frame = +2

Query:  98 NNGEDKQSQNLRHQEVGHKSLLQSDDLYQYILETSVYPREPESMKELREVTAKHPWNIMT 277
           NNGE KQ++  RHQEVGHKSLLQSD LYQYILETSVYPREPESMKELRE+TAKHPWN+MT
Sbjct:   3 NNGEGKQNEVSRHQEVGHKSLLQSDALYQYILETSVYPREPESMKELREITAKHPWNLMT 62

Query: 278 TSADEGQFLNMLIKLVNAKNTMEIGVYTGYSLLATALALPEDGKILAMDVNRENYELGLP 457
           TSADEGQFL+ML+KL+NAKNTMEIGV+TGYSLLATALALPEDGKILAMD+NRENYELGLP
Sbjct:  63 TSADEGQFLSMLLKLINAKNTMEIGVFTGYSLLATALALPEDGKILAMDINRENYELGLP 122

Query: 458 IIEKAGVAHKIDFREGPALPVLDQLVADEKNHGTYDFIFVDADKDNYINYHKRLIDLVKV 637
           +IEKAG+AHKIDFREGPALP LDQ++ D K HG++DFIFVDADKDNY+NYHKRLI+LVKV
Sbjct: 123 VIEKAGLAHKIDFREGPALPALDQMIEDGKYHGSFDFIFVDADKDNYLNYHKRLIELVKV 182

Query: 638 GGVIGYDNTLWNGSVVAPPDAPMRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITI 817
           GGVIGYDNTLWNGSVVAPPDAP+RKYVRYYRDFVLELNKALAADPRIEICMLPVGDGI I
Sbjct: 183 GGVIGYDNTLWNGSVVAPPDAPLRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGIPI 242

Query: 818 CRRIS 832
           CRR+S
Sbjct: 243 CRRVS 247

>gi|118484246|gb|ABK94003.1| unknown [Populus trichocarpa]

          Length = 247

 Score =  457 bits (1174), Expect = 2e-126
 Identities = 220/243 (90%), Positives = 236/243 (97%)
 Frame = +2

Query: 101 NGEDKQSQNLRHQEVGHKSLLQSDDLYQYILETSVYPREPESMKELREVTAKHPWNIMTT 280
           NGE++QSQ  RHQEVG+KSLLQSD LYQYILETSVYPREPE MKELREVTAKHPWNIMTT
Sbjct:   4 NGEEQQSQAGRHQEVGNKSLLQSDALYQYILETSVYPREPECMKELREVTAKHPWNIMTT 63

Query: 281 SADEGQFLNMLIKLVNAKNTMEIGVYTGYSLLATALALPEDGKILAMDVNRENYELGLPI 460
           SADEGQFLNML+KLVNAKNTMEIGVYTGYSLLATALA+PEDGKILAMD+NRENYELGLP+
Sbjct:  64 SADEGQFLNMLLKLVNAKNTMEIGVYTGYSLLATALAIPEDGKILAMDINRENYELGLPV 123

Query: 461 IEKAGVAHKIDFREGPALPVLDQLVADEKNHGTYDFIFVDADKDNYINYHKRLIDLVKVG 640
           I+KAGVAHKIDF+EGPALPVLDQ++ D K HG++DFIFVDADKDNYINYHKRLI+LVKVG
Sbjct: 124 IQKAGVAHKIDFKEGPALPVLDQMIEDGKCHGSFDFIFVDADKDNYINYHKRLIELVKVG 183

Query: 641 GVIGYDNTLWNGSVVAPPDAPMRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITIC 820
           G+IGYDNTLWNGSVVAPPDAPMRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGIT+C
Sbjct: 184 GLIGYDNTLWNGSVVAPPDAPMRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITLC 243

Query: 821 RRI 829
           RRI
Sbjct: 244 RRI 246

>gi|167613943|gb|ABZ89569.1| O-methyltransferase 5 [Humulus lupulus]

          Length = 247

 Score =  457 bits (1174), Expect = 2e-126
 Identities = 220/245 (89%), Positives = 233/245 (95%)
 Frame = +2

Query:  98 NNGEDKQSQNLRHQEVGHKSLLQSDDLYQYILETSVYPREPESMKELREVTAKHPWNIMT 277
           NNGE +Q Q  RHQEVGHKSLLQSD LYQYILETSVYPREPESMKELREVTAKHPWNIMT
Sbjct:   3 NNGEGEQXQVSRHQEVGHKSLLQSDALYQYILETSVYPREPESMKELREVTAKHPWNIMT 62

Query: 278 TSADEGQFLNMLIKLVNAKNTMEIGVYTGYSLLATALALPEDGKILAMDVNRENYELGLP 457
           TSADEGQFLNML+KL+NAKNTMEIGVYTGYSLLATALA+PEDGKILAMD+NRENYELGLP
Sbjct:  63 TSADEGQFLNMLLKLINAKNTMEIGVYTGYSLLATALAIPEDGKILAMDINRENYELGLP 122

Query: 458 IIEKAGVAHKIDFREGPALPVLDQLVADEKNHGTYDFIFVDADKDNYINYHKRLIDLVKV 637
           IIEKAGVAHKIDFREGPALPV DQ++ D K HG++DFIFVDADKDNY+NYHKRLIDLVKV
Sbjct: 123 IIEKAGVAHKIDFREGPALPVXDQMIEDGKYHGSFDFIFVDADKDNYLNYHKRLIDLVKV 182

Query: 638 GGVIGYDNTLWNGSVVAPPDAPMRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITI 817
           GGVIG DNTLWNGSVVAPPDAP+RKYVRYYRDFV+ELNKALAADPRIEIC LPVGDG+TI
Sbjct: 183 GGVIGXDNTLWNGSVVAPPDAPLRKYVRYYRDFVIELNKALAADPRIEICTLPVGDGVTI 242

Query: 818 CRRIS 832
           C RIS
Sbjct: 243 CHRIS 247

  Database: GenBank nr
    Posted date:  Thu Sep 08 23:06:31 2011
  Number of letters in database: 5,219,829,378
  Number of sequences in database:  15,229,318

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,687,995,622,555
Number of Sequences: 15229318
Number of Extensions: 1687995622555
Number of Successful Extensions: 433925934
Number of sequences better than 0.0: 0