Library    |     Search    |     Batch query    |     SNP    |     SSR  

TAIR blast output of UN19844


BLASTX 7.6.2

Query= UN19844 /QuerySize=946
        (945 letters)

Database: TAIR9 protein;
          33,410 sequences; 13,468,323 total letters
                                                                  Score    E
Sequences producing significant alignments:                       (bits) Value

TAIR9_protein||AT5G20290.1 | Symbols:  | 40S ribosomal protein S...    408   3e-114
TAIR9_protein||AT5G59240.1 | Symbols:  | 40S ribosomal protein S...    245   5e-065

>TAIR9_protein||AT5G20290.1 | Symbols:  | 40S ribosomal protein S8 (RPS8A) |
        chr5:6851695-6853012 REVERSE

          Length = 223

 Score =  408 bits (1047), Expect = 3e-114
 Identities = 207/229 (90%), Positives = 214/229 (93%), Gaps = 6/229 (2%)
 Frame = +3

Query:  75 MGISRDSIHKRRATGGKQKGWRKKRKYEMGRQPANTKLSSNKTVRRIRVRGGNVKWRALR 254
           MGISRDSIHKRRATGGKQK WRKKRKYEMGRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct:   1 MGISRDSIHKRRATGGKQKQWRKKRKYEMGRQPANTKLSSNKTVRRIRVRGGNVKWRALR 60

Query: 255 LDTGNYSWGSEAVTRKTRVLDVVYNASNNELVRTKTLVKSAIVQVDAAPFKQWYLQHYGV 434
           LDTGNYSWGSEA TRKTRVLDVVYNASNNELVRTKTLVKSAIVQVDAAPFKQWYL HYGV
Sbjct:  61 LDTGNYSWGSEATTRKTRVLDVVYNASNNELVRTKTLVKSAIVQVDAAPFKQWYLSHYGV 120

Query: 435 EVGRKKKNAASAAKKETEDGEEAAPAAAAAAAPEEVKKSNHVLRKIESRQEGRSLDSHIE 614
           E+GRKKK +AS+ KK+ E+GEE     AA AAPEEVKKSNH+LRKI SRQEGRSLDSHIE
Sbjct: 121 ELGRKKK-SASSTKKDGEEGEE-----AAVAAPEEVKKSNHLLRKIASRQEGRSLDSHIE 174

Query: 615 EQFASGRLLACISSRPGQCGRADGYILEGKELEFYQKKIQKKKGKGAA* 761
           +QFASGRLLACISSRPGQCGRADGYILEGKELEFY KKIQKKKGKGAA*
Sbjct: 175 DQFASGRLLACISSRPGQCGRADGYILEGKELEFYMKKIQKKKGKGAA* 223

>TAIR9_protein||AT5G59240.1 | Symbols:  | 40S ribosomal protein S8 (RPS8B) |
        chr5:23902626-23903670 REVERSE

          Length = 211

 Score =  245 bits (623), Expect = 5e-065
 Identities = 119/130 (91%), Positives = 125/130 (96%)
 Frame = +3

Query:  75 MGISRDSIHKRRATGGKQKGWRKKRKYEMGRQPANTKLSSNKTVRRIRVRGGNVKWRALR 254
           MGISRDSIHKRRATGGKQK WRKKRKYE+GRQPANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct:   1 MGISRDSIHKRRATGGKQKMWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR 60

Query: 255 LDTGNYSWGSEAVTRKTRVLDVVYNASNNELVRTKTLVKSAIVQVDAAPFKQWYLQHYGV 434
           LDTGN+SWGSEAVTRKTR+LDV YNASNNELVRT+TLVKSAIVQVDAAPFKQ YLQHYGV
Sbjct:  61 LDTGNFSWGSEAVTRKTRILDVAYNASNNELVRTQTLVKSAIVQVDAAPFKQGYLQHYGV 120

Query: 435 EVGRKKKNAA 464
           ++GRKKK  A
Sbjct: 121 DIGRKKKGEA 130


 Score =  138 bits (345), Expect = 9e-033
 Identities = 65/78 (83%), Positives = 71/78 (91%)
 Frame = +3

Query: 522 AAAPEEVKKSNHVLRKIESRQEGRSLDSHIEEQFASGRLLACISSRPGQCGRADGYILEG 701
           A   EEVKKSNHV RK+E RQEGR+LDSH+EEQF+SGRLLACI+SRPGQCGRADGYILEG
Sbjct: 130 AVTTEEVKKSNHVQRKLEMRQEGRALDSHLEEQFSSGRLLACIASRPGQCGRADGYILEG 189

Query: 702 KELEFYQKKIQKKKGKGA 755
           KELEFY KK+QKKKGK A
Sbjct: 190 KELEFYMKKLQKKKGKNA 207

  Database: TAIR9 protein
    Posted date:  Wed Jul 08 15:16:08 2009
  Number of letters in database: 13,468,323
  Number of sequences in database:  33,410

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 10,282,326,151
Number of Sequences: 33410
Number of Extensions: 10282326151
Number of Successful Extensions: 343552827
Number of sequences better than 0.0: 0