BLASTX 7.6.2

Query= UN67565 /QuerySize=742
        (741 letters)

Database: TAIR9 protein;
          33,410 sequences; 13,468,323 total letters
                                                                  Score    E
Sequences producing significant alignments:                       (bits) Value

TAIR9_protein||AT4G33780.1 | Symbols:  | FUNCTIONS IN: molecular...     50   1e-006

>TAIR9_protein||AT4G33780.1 | Symbols:  | FUNCTIONS IN: molecular_function
        unknown; INVOLVED IN: biological_process unknown; LOCATED IN:
        chloroplast; EXPRESSED IN: 24 plant structures; EXPRESSED DURING: 15
        growth stages; BEST Arabidopsis thaliana protein match is: SHW1 (SHORT
        HYPOCOTYL IN WHITE LIGHT1) (TAIR:AT1G69935.1); Has 20 Blast hits to 20
        proteins in 5 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi -
        0; Plants - 20; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink).
        | chr4:16202174-16203617 REVERSE

          Length = 204

 Score =  50 bits (119), Expect = 1e-006
 Identities = 32/57 (56%), Positives = 37/57 (64%), Gaps = 5/57 (8%)
 Frame = +2

Query:  83 SASISSPSSLAILSAQSRSPLSFSIFTPKTQVFSRTRIHDLCSSLIVSRRPLNLIHG 253
           SASISSPSS   L    RSPLSF IFTPKT +F+RTRI       + SRR  + I+G
Sbjct:   4 SASISSPSSSVAL---LRSPLSFFIFTPKTLIFTRTRISGF--PYLASRRSRDFING 55

  Database: TAIR9 protein
    Posted date:  Wed Jul 08 15:16:08 2009
  Number of letters in database: 13,468,323
  Number of sequences in database:  33,410

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 30,045,500,192
Number of Sequences: 33410
Number of Extensions: 30045500192
Number of Successful Extensions: 1011407149
Number of sequences better than 0.0: 0