BLASTX 7.6.2 Query= RU00024 /QuerySize=278 (277 letters) Database: TAIR9 protein; 33,410 sequences; 13,468,323 total letters Score E Sequences producing significant alignments: (bits) Value TAIR9_protein||AT2G24940.1 | Symbols: AtMAPR2 | AtMAPR2 (Arabido... 57 2e-009 >TAIR9_protein||AT2G24940.1 | Symbols: AtMAPR2 | AtMAPR2 (Arabidopsis thaliana membrane-associated progesterone binding protein 2); heme binding | chr2:10609447-10609749 FORWARD Length = 101 Score = 57 bits (136), Expect = 2e-009 Identities = 24/35 (68%), Positives = 29/35 (82%) Frame = -3 Query: 275 EEDITADLQGLSDKEIGVLTDWENKFEAKYPVVGR 171 EED++ L+GL++KEI L DWE KFEAKYPVVGR Sbjct: 63 EEDVSPSLEGLTEKEINTLNDWETKFEAKYPVVGR 97 Database: TAIR9 protein Posted date: Wed Jul 08 15:16:08 2009 Number of letters in database: 13,468,323 Number of sequences in database: 33,410 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 60,466,036 Number of Sequences: 33410 Number of Extensions: 60466036 Number of Successful Extensions: 5163212 Number of sequences better than 0.0: 0 |