BLASTX 7.6.2 Query= RU00039 /QuerySize=539 (538 letters) Database: TAIR9 protein; 33,410 sequences; 13,468,323 total letters Score E Sequences producing significant alignments: (bits) Value TAIR9_protein||AT3G51980.1 | Symbols: | binding | chr3:19285811... 86 1e-017 >TAIR9_protein||AT3G51980.1 | Symbols: | binding | chr3:19285811-19287502 REVERSE Length = 383 Score = 86 bits (212), Expect = 1e-017 Identities = 44/56 (78%), Positives = 50/56 (89%) Frame = +1 Query: 4 PSDAQLMKVAILDLKNSSLSLEDRHRALEELLELVEPIDNANDLNKLGGLAVVIGE 171 PS+A+LM++AI DL NSSLSLEDRHRAL+ELL LVEPIDNANDL+K GGL VV GE Sbjct: 113 PSNAKLMQIAIDDLNNSSLSLEDRHRALQELLILVEPIDNANDLSKSGGLRVVAGE 168 Database: TAIR9 protein Posted date: Wed Jul 08 15:16:08 2009 Number of letters in database: 13,468,323 Number of sequences in database: 33,410 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 60,466,036 Number of Sequences: 33410 Number of Extensions: 60466036 Number of Successful Extensions: 5163212 Number of sequences better than 0.0: 0 |