BLASTX 7.6.2 Query= RU00146 /QuerySize=295 (294 letters) Database: TAIR9 protein; 33,410 sequences; 13,468,323 total letters Score E Sequences producing significant alignments: (bits) Value TAIR9_protein||AT1G03350.1 | Symbols: | BSD domain-containing p... 59 5e-010 TAIR9_protein||AT4G13110.1 | Symbols: | BSD domain-containing p... 53 3e-008 >TAIR9_protein||AT1G03350.1 | Symbols: | BSD domain-containing protein | chr1:822834-824246 REVERSE Length = 471 Score = 59 bits (141), Expect = 5e-010 Identities = 25/54 (46%), Positives = 38/54 (70%) Frame = -1 Query: 162 MNTYLEEPEDLESYGEWKLGFVLEEKAEETENLMKENGVIGEIHEEIVPGEVDN 1 +NTY EEPED + Y +W+ F L+ KAEE E L++ENG + +++ +VP VD+ Sbjct: 163 LNTYCEEPEDSDDYKKWESAFSLDGKAEEMEKLLEENGDMKGVYKRVVPSMVDH 216 >TAIR9_protein||AT4G13110.1 | Symbols: | BSD domain-containing protein | chr4:7641507-7642457 FORWARD Length = 317 Score = 53 bits (126), Expect = 3e-008 Identities = 25/51 (49%), Positives = 32/51 (62%) Frame = -1 Query: 156 TYLEEPEDLESYGEWKLGFVLEEKAEETENLMKENGVIGEIHEEIVPGEVD 4 T++ EP+DL + W LG LEEK E L+ N + EI+EEIVP EVD Sbjct: 144 TFVREPDDLSDFENWSLGLKLEEKRNEIVELINGNKGVKEIYEEIVPVEVD 194 Database: TAIR9 protein Posted date: Wed Jul 08 15:16:08 2009 Number of letters in database: 13,468,323 Number of sequences in database: 33,410 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 122,173,568 Number of Sequences: 33410 Number of Extensions: 122173568 Number of Successful Extensions: 10168541 Number of sequences better than 0.0: 0 |