BLASTX 7.6.2 Query= RU01088 /QuerySize=223 (222 letters) Database: TAIR9 protein; 33,410 sequences; 13,468,323 total letters Score E Sequences producing significant alignments: (bits) Value TAIR9_protein||AT2G30590.1 | Symbols: WRKY21 | WRKY21; calmoduli... 53 3e-008 >TAIR9_protein||AT2G30590.1 | Symbols: WRKY21 | WRKY21; calmodulin binding / transcription factor | chr2:13033891-13035303 FORWARD Length = 381 Score = 53 bits (126), Expect = 3e-008 Identities = 23/32 (71%), Positives = 29/32 (90%) Frame = +3 Query: 111 AEMMYRRSNSGINLNFDSSSCTPTMSSTRSFI 206 AE+M R+ N GI+L+FD+SSCTPTMSSTRSF+ Sbjct: 199 AELMLRKCNGGISLSFDNSSCTPTMSSTRSFV 230 Database: TAIR9 protein Posted date: Wed Jul 08 15:16:08 2009 Number of letters in database: 13,468,323 Number of sequences in database: 33,410 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 390,802,586 Number of Sequences: 33410 Number of Extensions: 390802586 Number of Successful Extensions: 20688415 Number of sequences better than 0.0: 0 |