BLASTX 7.6.2 Query= RU01101 /QuerySize=909 (908 letters) Database: TAIR9 protein; 33,410 sequences; 13,468,323 total letters Score E Sequences producing significant alignments: (bits) Value TAIR9_protein||AT2G01740.1 | Symbols: | pentatricopeptide (PPR)... 54 1e-007 >TAIR9_protein||AT2G01740.1 | Symbols: | pentatricopeptide (PPR) repeat-containing protein | chr2:326136-327815 REVERSE Length = 560 Score = 54 bits (128), Expect = 1e-007 Identities = 32/87 (36%), Positives = 49/87 (56%), Gaps = 6/87 (6%) Frame = +1 Query: 79 INGYWKLCDIDVACLEMNMIRVGG---CRPDFVTFNTLFNGFCKVEVRREVFAYMGLM-- 243 I+G+ + DI A L + +R C+PD V+FN+LFNGF K+++ EVF YMG+M Sbjct: 98 IDGHCRNGDIRSASLVLESLRASHGFICKPDIVSFNSLFNGFSKMKMLDEVFVYMGVMLK 157 Query: 244 -CRRIFWLLLL*LMGICKVGNLKIAIR 321 C + CK G L++A++ Sbjct: 158 CCSPNVVTYSTWIDTFCKSGELQLALK 184 Database: TAIR9 protein Posted date: Wed Jul 08 15:16:08 2009 Number of letters in database: 13,468,323 Number of sequences in database: 33,410 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 390,802,586 Number of Sequences: 33410 Number of Extensions: 390802586 Number of Successful Extensions: 20688415 Number of sequences better than 0.0: 0 |