BLASTX 7.6.2 Query= RU01180 /QuerySize=548 (547 letters) Database: TAIR9 protein; 33,410 sequences; 13,468,323 total letters Score E Sequences producing significant alignments: (bits) Value TAIR9_protein||AT5G11650.1 | Symbols: | hydrolase, alpha/beta f... 71 3e-013 TAIR9_protein||AT1G18360.1 | Symbols: | hydrolase, alpha/beta f... 59 1e-009 TAIR9_protein||AT1G73480.1 | Symbols: | hydrolase, alpha/beta f... 59 2e-009 >TAIR9_protein||AT5G11650.1 | Symbols: | hydrolase, alpha/beta fold family protein | chr5:3745069-3746816 FORWARD Length = 391 Score = 71 bits (173), Expect = 3e-013 Identities = 32/40 (80%), Positives = 35/40 (87%) Frame = +3 Query: 6 EAASEFKDIKLYDGFLHDLLFEPEREEIAQDIIDWMEKRL 125 +A S FKDIKLYDGFLHDLLFEPEREE+ +DIIDWM RL Sbjct: 340 QAPSVFKDIKLYDGFLHDLLFEPEREEVGRDIIDWMMNRL 379 >TAIR9_protein||AT1G18360.1 | Symbols: | hydrolase, alpha/beta fold family protein | chr1:6316996-6319204 REVERSE Length = 383 Score = 59 bits (142), Expect = 1e-009 Identities = 27/40 (67%), Positives = 32/40 (80%) Frame = +3 Query: 6 EAASEFKDIKLYDGFLHDLLFEPEREEIAQDIIDWMEKRL 125 EA+S K IKLYDG LHDLLFEPERE IA I+DW+ +R+ Sbjct: 343 EASSSDKSIKLYDGLLHDLLFEPERETIAGVILDWLNRRV 382 >TAIR9_protein||AT1G73480.1 | Symbols: | hydrolase, alpha/beta fold family protein | chr1:27629266-27632486 FORWARD Length = 464 Score = 59 bits (141), Expect = 2e-009 Identities = 27/40 (67%), Positives = 32/40 (80%) Frame = +3 Query: 6 EAASEFKDIKLYDGFLHDLLFEPEREEIAQDIIDWMEKRL 125 EAAS K +KLYDG LHDLLFEPERE IA I+DW+ +R+ Sbjct: 424 EAASSDKSLKLYDGLLHDLLFEPEREIIAGAILDWLNQRV 463 Database: TAIR9 protein Posted date: Wed Jul 08 15:16:08 2009 Number of letters in database: 13,468,323 Number of sequences in database: 33,410 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 450,328,727 Number of Sequences: 33410 Number of Extensions: 450328727 Number of Successful Extensions: 25624131 Number of sequences better than 0.0: 0 |