BLASTX 7.6.2 Query= RU01502 /QuerySize=1054 (1053 letters) Database: TAIR9 protein; 33,410 sequences; 13,468,323 total letters Score E Sequences producing significant alignments: (bits) Value TAIR9_protein||AT3G25400.1 | Symbols: | FUNCTIONS IN: molecular... 158 1e-038 >TAIR9_protein||AT3G25400.1 | Symbols: | FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: cellular_component unknown; EXPRESSED IN: 11 plant structures; EXPRESSED DURING: 6 growth stages; CONTAINS InterPro DOMAIN/s: NTP Pyrophosphohydrolase MazG-related, RS21-C6 (InterPro:IPR011394), EAR (InterPro:IPR009039), NTP pyrophosphohydrolase MazG, putative catalytic core (InterPro:IPR004518); Has 572 Blast hits to 572 proteins in 181 species: Archae - 11; Bacteria - 286; Metazoa - 71; Fungi - 1; Plants - 31; Viruses - 0; Other Eukaryotes - 172 (source: NCBI BLink). | chr3:9213236-9214144 FORWARD Length = 142 Score = 158 bits (397), Expect = 1e-038 Identities = 76/110 (69%), Positives = 85/110 (77%) Frame = +1 Query: 220 GFSEAESVTLDLLKKKMAEFARERNWDKFHSPRNXXXXXXXXXXXXSEIFQWKGEVPKGL 399 G + E V+L L KKM +FA+ R+W+K+HSPRN SEIFQWKGEV +G Sbjct: 7 GGEDKEVVSLQTLSKKMDDFAKARDWEKYHSPRNLLLAMVGEVGELSEIFQWKGEVARGC 66 Query: 400 PDWKEEEKQHLGEELSDVLLYLVRLSDICGVDLGKAALRKVELNAIKYPV 549 PDWKEEEK HLGEELSDVLLYLVRLSD CGVDLGKAALRK+ELNAIKYPV Sbjct: 67 PDWKEEEKVHLGEELSDVLLYLVRLSDACGVDLGKAALRKIELNAIKYPV 116 Database: TAIR9 protein Posted date: Wed Jul 08 15:16:08 2009 Number of letters in database: 13,468,323 Number of sequences in database: 33,410 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 569,754,700 Number of Sequences: 33410 Number of Extensions: 569754700 Number of Successful Extensions: 35675669 Number of sequences better than 0.0: 0 |