BLASTX 7.6.2 Query= RU02359 /QuerySize=283 (282 letters) Database: TAIR9 protein; 33,410 sequences; 13,468,323 total letters Score E Sequences producing significant alignments: (bits) Value TAIR9_protein||AT3G52250.1 | Symbols: | DNA binding / transcrip... 131 1e-031 >TAIR9_protein||AT3G52250.1 | Symbols: | DNA binding / transcription factor | chr3:19376629-19383100 FORWARD Length = 1657 Score = 131 bits (327), Expect = 1e-031 Identities = 57/91 (62%), Positives = 76/91 (83%) Frame = +2 Query: 8 SQVKLYRNSLKMPALILDKKEKIVTRFVSSNGLVEDPCAVEKERALINPWTPEEKEAFIE 187 + +K +R+ LKMPA+ILD+KE++++RF+SSNGL+EDPC VEKER +INPWT EEKE F+ Sbjct: 819 THLKPFRDILKMPAMILDEKERVMSRFISSNGLIEDPCDVEKERTMINPWTSEEKEIFLN 878 Query: 188 KLVVFGKDFKKIASFFDHKTTADCVEFYYKH 280 L + GKDFKKIAS KTTADC+++YYK+ Sbjct: 879 LLAMHGKDFKKIASSLTQKTTADCIDYYYKN 909 Database: TAIR9 protein Posted date: Wed Jul 08 15:16:08 2009 Number of letters in database: 13,468,323 Number of sequences in database: 33,410 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 776,313,954 Number of Sequences: 33410 Number of Extensions: 776313954 Number of Successful Extensions: 41180746 Number of sequences better than 0.0: 0 |