Blast details for RU03108 (Arabidopsis)


BLASTX 7.6.2

Query= RU03108 /QuerySize=867
        (866 letters)

Database: TAIR9 protein;
          33,410 sequences; 13,468,323 total letters
                                                                  Score    E
Sequences producing significant alignments:                       (bits) Value

TAIR9_protein||AT1G20970.1 | Symbols:  | FUNCTIONS IN: molecular...     51   1e-006

>TAIR9_protein||AT1G20970.1 | Symbols:  | FUNCTIONS IN: molecular_function
        unknown; INVOLVED IN: biological_process unknown; LOCATED IN: plasma
        membrane, vacuole; EXPRESSED IN: guard cell, cultured cell; BEST
        Arabidopsis thaliana protein match is: PPI1 (PROTON PUMP INTERACTOR 1);
        protein binding (TAIR:AT4G27500.1); Has 53409 Blast hits to 33585
        proteins in 1572 species: Archae - 464; Bacteria - 7066; Metazoa -
        25076; Fungi - 5173; Plants - 1740; Viruses - 257; Other Eukaryotes -
        13633 (source: NCBI BLink). | chr1:7314338-7319246 FORWARD

          Length = 1365

 Score =  51 bits (120), Expect = 1e-006
 Identities = 26/45 (57%), Positives = 34/45 (75%), Gaps = 2/45 (4%)
 Frame = -1

Query:  482 KRSQK-APQFTKQTKVKSIPLPLRNR-SKRRMQPWMWVLVTVVAI 354
            K+S K + QF KQ K KS+PLPLRNR SKR+++ WMW+ + VV I
Sbjct: 1300 KKSHKPSSQFLKQNKSKSVPLPLRNRGSKRKLRQWMWIGLIVVII 1344

  Database: TAIR9 protein
    Posted date:  Wed Jul 08 15:16:08 2009
  Number of letters in database: 13,468,323
  Number of sequences in database:  33,410

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 922,250,500
Number of Sequences: 33410
Number of Extensions: 922250500
Number of Successful Extensions: 51428098
Number of sequences better than 0.0: 0