BLASTX 7.6.2 Query= RU03479 /QuerySize=360 (359 letters) Database: TAIR9 protein; 33,410 sequences; 13,468,323 total letters Score E Sequences producing significant alignments: (bits) Value TAIR9_protein||AT2G18840.1 | Symbols: | integral membrane Yip1 ... 62 4e-011 TAIR9_protein||AT4G30260.1 | Symbols: | integral membrane Yip1 ... 52 6e-008 >TAIR9_protein||AT2G18840.1 | Symbols: | integral membrane Yip1 family protein | chr2:8158288-8159848 FORWARD Length = 282 Score = 62 bits (150), Expect = 4e-011 Identities = 30/34 (88%), Positives = 31/34 (91%) Frame = +1 Query: 43 ESDTVPLHPSSQSDIDEIENLINASVQSGPTTVL 144 + DTVPLHPSSQSDIDEIENLIN SVQSGP TVL Sbjct: 3 QGDTVPLHPSSQSDIDEIENLINESVQSGPGTVL 36 >TAIR9_protein||AT4G30260.1 | Symbols: | integral membrane Yip1 family protein | chr4:14816890-14818722 REVERSE Length = 281 Score = 52 bits (123), Expect = 6e-008 Identities = 24/33 (72%), Positives = 29/33 (87%) Frame = +1 Query: 46 SDTVPLHPSSQSDIDEIENLINASVQSGPTTVL 144 +DT+PL+ SSQSDIDEIEN++N S QSGP TVL Sbjct: 4 NDTIPLYQSSQSDIDEIENMMNDSFQSGPGTVL 36 Database: TAIR9 protein Posted date: Wed Jul 08 15:16:08 2009 Number of letters in database: 13,468,323 Number of sequences in database: 33,410 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 981,265,849 Number of Sequences: 33410 Number of Extensions: 981265849 Number of Successful Extensions: 51510975 Number of sequences better than 0.0: 0 |