BLASTX 7.6.2 Query= RU03777 /QuerySize=729 (728 letters) Database: TAIR9 protein; 33,410 sequences; 13,468,323 total letters Score E Sequences producing significant alignments: (bits) Value TAIR9_protein||AT5G64130.1 | Symbols: | FUNCTIONS IN: molecular... 121 6e-028 TAIR9_protein||AT5G64130.3 | Symbols: | FUNCTIONS IN: molecular... 121 6e-028 TAIR9_protein||AT1G69510.1 | Symbols: | FUNCTIONS IN: molecular... 81 7e-016 TAIR9_protein||AT1G69510.3 | Symbols: | FUNCTIONS IN: molecular... 81 7e-016 TAIR9_protein||AT1G69510.2 | Symbols: | FUNCTIONS IN: molecular... 81 7e-016 TAIR9_protein||AT5G64130.2 | Symbols: | unknown protein | chr5:... 61 7e-010 >TAIR9_protein||AT5G64130.1 | Symbols: | FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: plasma membrane; EXPRESSED IN: 24 plant structures; EXPRESSED DURING: 15 growth stages; CONTAINS InterPro DOMAIN/s: Lg106-like (InterPro:IPR012482); BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT1G69510.3); Has 93 Blast hits to 93 proteins in 12 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 93; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). | chr5:25664547-25665339 REVERSE Length = 116 Score = 121 bits (302), Expect = 6e-028 Identities = 58/67 (86%), Positives = 60/67 (89%), Gaps = 1/67 (1%) Frame = -2 Query: 514 DHERAYFDSADWALGKQGVEKPKGPLEALRPKLQPTQQQTRYRKSPCAPSE-GEDGGGAP 338 DHERAYFDSADWALGKQGV KPKGPLEALRPKLQPTQQQTRYRKSPCAPSE GEDGG A Sbjct: 49 DHERAYFDSADWALGKQGVAKPKGPLEALRPKLQPTQQQTRYRKSPCAPSEGGEDGGAAQ 108 Query: 337 SEDTAAN 317 +E + N Sbjct: 109 AEGGSGN 115 >TAIR9_protein||AT5G64130.3 | Symbols: | FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: plasma membrane; EXPRESSED IN: 24 plant structures; EXPRESSED DURING: 15 growth stages; CONTAINS InterPro DOMAIN/s: Lg106-like (InterPro:IPR012482); BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT1G69510.3); Has 91 Blast hits to 91 proteins in 11 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 91; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). | chr5:25664547-25665339 REVERSE Length = 141 Score = 121 bits (302), Expect = 6e-028 Identities = 58/67 (86%), Positives = 60/67 (89%), Gaps = 1/67 (1%) Frame = -2 Query: 514 DHERAYFDSADWALGKQGVEKPKGPLEALRPKLQPTQQQTRYRKSPCAPSE-GEDGGGAP 338 DHERAYFDSADWALGKQGV KPKGPLEALRPKLQPTQQQTRYRKSPCAPSE GEDGG A Sbjct: 74 DHERAYFDSADWALGKQGVAKPKGPLEALRPKLQPTQQQTRYRKSPCAPSEGGEDGGAAQ 133 Query: 337 SEDTAAN 317 +E + N Sbjct: 134 AEGGSGN 140 >TAIR9_protein||AT1G69510.1 | Symbols: | FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: cellular_component unknown; EXPRESSED IN: 23 plant structures; EXPRESSED DURING: 15 growth stages; CONTAINS InterPro DOMAIN/s: Lg106-like (InterPro:IPR012482); BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT5G64130.1); Has 92 Blast hits to 92 proteins in 12 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 92; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). | chr1:26126779-26127725 FORWARD Length = 138 Score = 81 bits (198), Expect = 7e-016 Identities = 44/74 (59%), Positives = 50/74 (67%), Gaps = 5/74 (6%) Frame = -2 Query: 514 DHERAYFDSADWALGKQGVEKPKGPLEALRPKLQPT-QQQTRYRKSPCAPSEGE----DG 350 DHERA+FDSADWALGKQ +KPKGPLEALRPKLQPT QQQ R R+ + E E D Sbjct: 48 DHERAFFDSADWALGKQKGQKPKGPLEALRPKLQPTPQQQPRARRMAYSSGETEDTEIDN 107 Query: 349 GGAPSEDTAANE*D 308 AP + A+ D Sbjct: 108 NEAPDDQACASAVD 121 >TAIR9_protein||AT1G69510.3 | Symbols: | FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: cellular_component unknown; EXPRESSED IN: 23 plant structures; EXPRESSED DURING: 15 growth stages; CONTAINS InterPro DOMAIN/s: Lg106-like (InterPro:IPR012482); BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT5G64130.1); Has 92 Blast hits to 92 proteins in 12 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 92; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). | chr1:26126779-26127725 FORWARD Length = 138 Score = 81 bits (198), Expect = 7e-016 Identities = 44/74 (59%), Positives = 50/74 (67%), Gaps = 5/74 (6%) Frame = -2 Query: 514 DHERAYFDSADWALGKQGVEKPKGPLEALRPKLQPT-QQQTRYRKSPCAPSEGE----DG 350 DHERA+FDSADWALGKQ +KPKGPLEALRPKLQPT QQQ R R+ + E E D Sbjct: 48 DHERAFFDSADWALGKQKGQKPKGPLEALRPKLQPTPQQQPRARRMAYSSGETEDTEIDN 107 Query: 349 GGAPSEDTAANE*D 308 AP + A+ D Sbjct: 108 NEAPDDQACASAVD 121 >TAIR9_protein||AT1G69510.2 | Symbols: | FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: cellular_component unknown; EXPRESSED IN: 23 plant structures; EXPRESSED DURING: 15 growth stages; CONTAINS InterPro DOMAIN/s: Lg106-like (InterPro:IPR012482); BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT5G64130.1); Has 92 Blast hits to 92 proteins in 12 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 92; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). | chr1:26126779-26127725 FORWARD Length = 138 Score = 81 bits (198), Expect = 7e-016 Identities = 44/74 (59%), Positives = 50/74 (67%), Gaps = 5/74 (6%) Frame = -2 Query: 514 DHERAYFDSADWALGKQGVEKPKGPLEALRPKLQPT-QQQTRYRKSPCAPSEGE----DG 350 DHERA+FDSADWALGKQ +KPKGPLEALRPKLQPT QQQ R R+ + E E D Sbjct: 48 DHERAFFDSADWALGKQKGQKPKGPLEALRPKLQPTPQQQPRARRMAYSSGETEDTEIDN 107 Query: 349 GGAPSEDTAANE*D 308 AP + A+ D Sbjct: 108 NEAPDDQACASAVD 121 >TAIR9_protein||AT5G64130.2 | Symbols: | unknown protein | chr5:25664540-25665145 REVERSE Length = 84 Score = 61 bits (146), Expect = 7e-010 Identities = 40/73 (54%), Positives = 47/73 (64%), Gaps = 1/73 (1%) Frame = -3 Query: 555 MVESFRRNHH*FLRTMNVLTLILLIGRLESKVLRSLKDHLKPFGQNYSLHNSKQDTESLL 376 M S +RNH F R M+ TL LIG LESKVLRS +D KPF +YS +S+ T SL Sbjct: 1 MEGSCQRNHLSFPRIMSEHTLTQLIGLLESKVLRSQRDPWKPFVPSYSQRSSRHVTGSLH 60 Query: 375 VLHPR-AKMEEVL 340 VLH R KMEE+L Sbjct: 61 VLHLRVVKMEELL 73 Database: TAIR9 protein Posted date: Wed Jul 08 15:16:08 2009 Number of letters in database: 13,468,323 Number of sequences in database: 33,410 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 1,039,283,375 Number of Sequences: 33410 Number of Extensions: 1039283375 Number of Successful Extensions: 51547929 Number of sequences better than 0.0: 0 |