BLASTX 7.6.2 Query= RU03862 /QuerySize=472 (471 letters) Database: TAIR9 protein; 33,410 sequences; 13,468,323 total letters Score E Sequences producing significant alignments: (bits) Value TAIR9_protein||AT3G52500.1 | Symbols: | aspartyl protease famil... 95 2e-020 >TAIR9_protein||AT3G52500.1 | Symbols: | aspartyl protease family protein | chr3:19465644-19467053 REVERSE Length = 470 Score = 95 bits (235), Expect = 2e-020 Identities = 44/71 (61%), Positives = 54/71 (76%) Frame = +1 Query: 34 KGGAKMALPLSNYFALVTSGGVVCLTIVTDGVAGPNLPSGPAIILGSFQQQNFYVEYDLA 213 KGGAK+ LPLSNYF V + VCLT+V+D P+ +GPAIILGSFQQQN+ VEYDL Sbjct: 397 KGGAKLELPLSNYFTFVGNTDTVCLTVVSDKTVNPSGGTGPAIILGSFQQQNYLVEYDLE 456 Query: 214 HDRFGFRQQSC 246 +DRFGF ++ C Sbjct: 457 NDRFGFAKKKC 467 Database: TAIR9 protein Posted date: Wed Jul 08 15:16:08 2009 Number of letters in database: 13,468,323 Number of sequences in database: 33,410 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 1,039,283,375 Number of Sequences: 33410 Number of Extensions: 1039283375 Number of Successful Extensions: 51547929 Number of sequences better than 0.0: 0 |