BLASTX 7.6.2 Query= RU04710 /QuerySize=418 (417 letters) Database: TAIR9 protein; 33,410 sequences; 13,468,323 total letters Score E Sequences producing significant alignments: (bits) Value TAIR9_protein||AT3G18430.1 | Symbols: | calcium-binding EF hand... 84 2e-017 >TAIR9_protein||AT3G18430.1 | Symbols: | calcium-binding EF hand family protein | chr3:6326180-6327476 FORWARD Length = 176 Score = 84 bits (207), Expect = 2e-017 Identities = 38/61 (62%), Positives = 52/61 (85%) Frame = +2 Query: 2 LLEVLRDMSGSFMSDEQREKVLTQVLQESGYSRGSYLTLDDFSKVLGGHGLKMEVEVPID 181 ++EVLRD+SGSFMSDEQRE+VL+QVL+ESGY+ S+LTL+DF K+ G +M+VE+P+D Sbjct: 116 IMEVLRDLSGSFMSDEQREQVLSQVLKESGYTSDSFLTLEDFIKIFGSSRPEMDVEIPVD 175 Query: 182 * 184 * Sbjct: 176 * 176 Database: TAIR9 protein Posted date: Wed Jul 08 15:16:08 2009 Number of letters in database: 13,468,323 Number of sequences in database: 33,410 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 1,211,404,566 Number of Sequences: 33410 Number of Extensions: 1211404566 Number of Successful Extensions: 66311372 Number of sequences better than 0.0: 0 |