BLASTX 7.6.2 Query= RU05136 /QuerySize=607 (606 letters) Database: TAIR9 protein; 33,410 sequences; 13,468,323 total letters Score E Sequences producing significant alignments: (bits) Value TAIR9_protein||AT2G02100.1 | Symbols: LCR69, PDF2.2 | LCR69 (LOW... 60 9e-010 TAIR9_protein||AT1G61070.1 | Symbols: LCR66, PDF2.4 | LCR66 (LOW... 47 8e-006 >TAIR9_protein||AT2G02100.1 | Symbols: LCR69, PDF2.2 | LCR69 (LOW-MOLECULAR-WEIGHT CYSTEINE-RICH 69); peptidase inhibitor | chr2:528397-528885 FORWARD Length = 78 Score = 60 bits (144), Expect = 9e-010 Identities = 28/58 (48%), Positives = 39/58 (67%), Gaps = 3/58 (5%) Frame = +3 Query: 147 MRMFSTFFVGLLLLVATAGIGPNVMVAEARKCESQSHKFAGICLIESNCASICKTEGY 320 MR+ S + ++ VAT G+GP + EAR CESQSH+F G C+ SNCA++C EG+ Sbjct: 5 MRLISAVLIMFMIFVAT-GMGP--VTVEARTCESQSHRFKGTCVSASNCANVCHNEGF 59 >TAIR9_protein||AT1G61070.1 | Symbols: LCR66, PDF2.4 | LCR66 (LOW-MOLECULAR-WEIGHT CYSTEINE-RICH 66) | chr1:22492020-22492470 REVERSE Length = 77 Score = 47 bits (110), Expect = 8e-006 Identities = 22/49 (44%), Positives = 29/49 (59%) Frame = +3 Query: 177 LLLLVATAGIGPNVMVAEARKCESQSHKFAGICLIESNCASICKTEGYS 323 LLLL ++ EAR CE+ S+ F G CL SNCA++C EG+S Sbjct: 11 LLLLFMILATVMGLVTVEARTCETSSNLFNGPCLSSSNCANVCHNEGFS 59 Database: TAIR9 protein Posted date: Wed Jul 08 15:16:08 2009 Number of letters in database: 13,468,323 Number of sequences in database: 33,410 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 1,269,989,486 Number of Sequences: 33410 Number of Extensions: 1269989486 Number of Successful Extensions: 71327439 Number of sequences better than 0.0: 0 |