BLASTX 7.6.2 Query= RU05627 /QuerySize=306 (305 letters) Database: TAIR9 protein; 33,410 sequences; 13,468,323 total letters Score E Sequences producing significant alignments: (bits) Value TAIR9_protein||AT5G04590.1 | Symbols: SIR | SIR; sulfite reducta... 52 4e-008 >TAIR9_protein||AT5G04590.1 | Symbols: SIR | SIR; sulfite reductase (ferredoxin)/ sulfite reductase | chr5:1319404-1322298 FORWARD Length = 643 Score = 52 bits (124), Expect = 4e-008 Identities = 31/62 (50%), Positives = 39/62 (62%), Gaps = 2/62 (3%) Frame = +2 Query: 125 EPKVEIGRYQGLRSANSLALTAGGRRVTLF--NAXXXXXXLIRAVSTPAKPETATKRSKV 298 + K+ +GR LRS++S+ L GR +A I+AVSTPAKPETATKRSKV Sbjct: 18 DQKIRLGRLDALRSSHSVFLGRYGRGGVPVPPSASSSSSSPIQAVSTPAKPETATKRSKV 77 Query: 299 EI 304 EI Sbjct: 78 EI 79 Database: TAIR9 protein Posted date: Wed Jul 08 15:16:08 2009 Number of letters in database: 13,468,323 Number of sequences in database: 33,410 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 1,450,188,973 Number of Sequences: 33410 Number of Extensions: 1450188973 Number of Successful Extensions: 86678781 Number of sequences better than 0.0: 0 |