BLASTX 7.6.2 Query= RU06669 /QuerySize=492 (491 letters) Database: TAIR9 protein; 33,410 sequences; 13,468,323 total letters Score E Sequences producing significant alignments: (bits) Value TAIR9_protein||AT4G32460.1 | Symbols: | FUNCTIONS IN: molecular... 119 1e-027 TAIR9_protein||AT4G32460.2 | Symbols: | FUNCTIONS IN: molecular... 119 1e-027 TAIR9_protein||AT5G11420.1 | Symbols: | FUNCTIONS IN: molecular... 118 2e-027 TAIR9_protein||AT5G25460.1 | Symbols: | unknown protein | chr5:... 114 3e-026 TAIR9_protein||AT1G80240.1 | Symbols: | unknown protein | chr1:... 84 3e-017 TAIR9_protein||AT2G41800.1 | Symbols: | FUNCTIONS IN: molecular... 65 1e-011 TAIR9_protein||AT3G08030.1 | Symbols: | unknown protein | chr3:... 63 7e-011 TAIR9_protein||AT3G08030.2 | Symbols: | unknown protein | chr3:... 63 7e-011 TAIR9_protein||AT1G29980.2 | Symbols: | INVOLVED IN: biological... 62 2e-010 TAIR9_protein||AT1G29980.1 | Symbols: | INVOLVED IN: biological... 62 2e-010 TAIR9_protein||AT2G41810.1 | Symbols: | FUNCTIONS IN: molecular... 62 2e-010 TAIR9_protein||AT2G34510.1 | Symbols: | FUNCTIONS IN: molecular... 62 2e-010 >TAIR9_protein||AT4G32460.1 | Symbols: | FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: plant-type cell wall; EXPRESSED IN: 24 plant structures; EXPRESSED DURING: 15 growth stages; CONTAINS InterPro DOMAIN/s: Protein of unknown function DUF642 (InterPro:IPR006946), Galactose-binding like (InterPro:IPR008979); BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT5G11420.1); Has 182 Blast hits to 158 proteins in 12 species: Archae - 0; Bacteria - 2; Metazoa - 0; Fungi - 0; Plants - 180; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). | chr4:15663036-15664859 REVERSE Length = 366 Score = 119 bits (296), Expect = 1e-027 Identities = 54/68 (79%), Positives = 64/68 (94%) Frame = +2 Query: 47 FAGRNTVKVPYESKGKGGFKRAVLKFVSVSNRTRIMFLSTFYTMRSDDFSSLCGPVLDDV 226 FAG++T+KVPYESKGKGGFKR+ L+FV+VS+RTR+MF STFY MR+DDFSSLCGPV+DDV Sbjct: 298 FAGKDTIKVPYESKGKGGFKRSSLRFVAVSSRTRVMFYSTFYAMRNDDFSSLCGPVIDDV 357 Query: 227 KLLSLRRP 250 KLLS RRP Sbjct: 358 KLLSARRP 365 >TAIR9_protein||AT4G32460.2 | Symbols: | FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: plant-type cell wall; EXPRESSED IN: 24 plant structures; EXPRESSED DURING: 15 growth stages; CONTAINS InterPro DOMAIN/s: Protein of unknown function DUF642 (InterPro:IPR006946), Galactose-binding like (InterPro:IPR008979); BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT5G11420.1); Has 182 Blast hits to 158 proteins in 12 species: Archae - 0; Bacteria - 2; Metazoa - 0; Fungi - 0; Plants - 180; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). | chr4:15663036-15664859 REVERSE Length = 366 Score = 119 bits (296), Expect = 1e-027 Identities = 54/68 (79%), Positives = 64/68 (94%) Frame = +2 Query: 47 FAGRNTVKVPYESKGKGGFKRAVLKFVSVSNRTRIMFLSTFYTMRSDDFSSLCGPVLDDV 226 FAG++T+KVPYESKGKGGFKR+ L+FV+VS+RTR+MF STFY MR+DDFSSLCGPV+DDV Sbjct: 298 FAGKDTIKVPYESKGKGGFKRSSLRFVAVSSRTRVMFYSTFYAMRNDDFSSLCGPVIDDV 357 Query: 227 KLLSLRRP 250 KLLS RRP Sbjct: 358 KLLSARRP 365 >TAIR9_protein||AT5G11420.1 | Symbols: | FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: cell wall, plant-type cell wall; EXPRESSED IN: 23 plant structures; EXPRESSED DURING: 13 growth stages; CONTAINS InterPro DOMAIN/s: Protein of unknown function DUF642 (InterPro:IPR006946), Galactose-binding like (InterPro:IPR008979); BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT5G25460.1); Has 185 Blast hits to 157 proteins in 11 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 185; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). | chr5:3644655-3646991 FORWARD Length = 367 Score = 118 bits (294), Expect = 2e-027 Identities = 54/68 (79%), Positives = 64/68 (94%) Frame = +2 Query: 47 FAGRNTVKVPYESKGKGGFKRAVLKFVSVSNRTRIMFLSTFYTMRSDDFSSLCGPVLDDV 226 FAG++T+KVPYES+GKGGFKRA L+FV+VS RTR+MF STFY+MRSDDFSSLCGPV+DDV Sbjct: 299 FAGKDTLKVPYESRGKGGFKRASLRFVAVSTRTRVMFYSTFYSMRSDDFSSLCGPVIDDV 358 Query: 227 KLLSLRRP 250 KLLS R+P Sbjct: 359 KLLSARKP 366 >TAIR9_protein||AT5G25460.1 | Symbols: | unknown protein | chr5:8863430-8865394 FORWARD Length = 370 Score = 114 bits (285), Expect = 3e-026 Identities = 52/68 (76%), Positives = 63/68 (92%) Frame = +2 Query: 47 FAGRNTVKVPYESKGKGGFKRAVLKFVSVSNRTRIMFLSTFYTMRSDDFSSLCGPVLDDV 226 FAG++T+KVPYESKG GGFKRA ++FV+VS R+RIMF STFY MRSDDFSSLCGPV+DDV Sbjct: 302 FAGKDTLKVPYESKGTGGFKRASIRFVAVSTRSRIMFYSTFYAMRSDDFSSLCGPVIDDV 361 Query: 227 KLLSLRRP 250 KL+S+R+P Sbjct: 362 KLISVRKP 369 >TAIR9_protein||AT1G80240.1 | Symbols: | unknown protein | chr1:30171520-30172799 REVERSE Length = 371 Score = 84 bits (207), Expect = 3e-017 Identities = 41/69 (59%), Positives = 52/69 (75%) Frame = +2 Query: 47 FAGRNTVKVPYESKGKGGFKRAVLKFVSVSNRTRIMFLSTFYTMRSDDFSSLCGPVLDDV 226 FAG+ V V Y SKGKGGF+R L F +VS RTR+ FLSTFY M+SD SLCGPV+DDV Sbjct: 301 FAGQGKVMVDYASKGKGGFRRGRLVFKAVSARTRVTFLSTFYHMKSDHSGSLCGPVIDDV 360 Query: 227 KLLSLRRPR 253 +L+++ + R Sbjct: 361 RLVAVGKLR 369 >TAIR9_protein||AT2G41800.1 | Symbols: | FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: cell wall, plant-type cell wall; EXPRESSED IN: 7 plant structures; EXPRESSED DURING: 4 anthesis, C globular stage, petal differentiation and expansion stage; CONTAINS InterPro DOMAIN/s: Protein of unknown function DUF642 (InterPro:IPR006946), Galactose-binding like (InterPro:IPR008979); BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT2G41810.1); Has 156 Blast hits to 155 proteins in 11 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 156; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). | chr2:17436671-17438005 REVERSE Length = 371 Score = 65 bits (158), Expect = 1e-011 Identities = 31/60 (51%), Positives = 39/60 (65%) Frame = +2 Query: 47 FAGRNTVKVPYESKGKGGFKRAVLKFVSVSNRTRIMFLSTFYTMRSDDFSSLCGPVLDDV 226 FAGR K+ + S+GKG FK +FV+ S+RTR+ F S FY + DF LCGPVLD V Sbjct: 305 FAGREPFKLSFMSEGKGAFKTGHFRFVADSDRTRLTFYSAFYHTKLHDFGHLCGPVLDSV 364 >TAIR9_protein||AT3G08030.1 | Symbols: | unknown protein | chr3:2564191-2565819 FORWARD Length = 366 Score = 63 bits (152), Expect = 7e-011 Identities = 31/60 (51%), Positives = 39/60 (65%) Frame = +2 Query: 47 FAGRNTVKVPYESKGKGGFKRAVLKFVSVSNRTRIMFLSTFYTMRSDDFSSLCGPVLDDV 226 FA R+T+KVP+ S G G K A KF +V RTRI F S FY + D SLCGPV+D++ Sbjct: 300 FAARDTLKVPHTSVGGGHVKTASFKFKAVEARTRITFFSGFYHTKKTDTVSLCGPVIDEI 359 >TAIR9_protein||AT3G08030.2 | Symbols: | unknown protein | chr3:2564517-2565819 FORWARD Length = 324 Score = 63 bits (152), Expect = 7e-011 Identities = 31/60 (51%), Positives = 39/60 (65%) Frame = +2 Query: 47 FAGRNTVKVPYESKGKGGFKRAVLKFVSVSNRTRIMFLSTFYTMRSDDFSSLCGPVLDDV 226 FA R+T+KVP+ S G G K A KF +V RTRI F S FY + D SLCGPV+D++ Sbjct: 258 FAARDTLKVPHTSVGGGHVKTASFKFKAVEARTRITFFSGFYHTKKTDTVSLCGPVIDEI 317 >TAIR9_protein||AT1G29980.2 | Symbols: | INVOLVED IN: biological_process unknown; LOCATED IN: plasma membrane, anchored to membrane; EXPRESSED IN: 24 plant structures; EXPRESSED DURING: 13 growth stages; CONTAINS InterPro DOMAIN/s: Protein of unknown function DUF642 (InterPro:IPR006946), Galactose-binding like (InterPro:IPR008979); BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT2G34510.1); Has 174 Blast hits to 163 proteins in 15 species: Archae - 0; Bacteria - 10; Metazoa - 0; Fungi - 0; Plants - 164; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). | chr1:10503411-10504617 REVERSE Length = 372 Score = 62 bits (149), Expect = 2e-010 Identities = 27/62 (43%), Positives = 40/62 (64%) Frame = +2 Query: 47 FAGRNTVKVPYESKGKGGFKRAVLKFVSVSNRTRIMFLSTFYTMRSDDFSSLCGPVLDDV 226 FAG Y ++ F++A L F + ++RTR+ F S +Y R+DD SSLCGPV+DDV Sbjct: 285 FAGDQAQNFHYMAQANSSFEKAGLNFTAKADRTRVAFYSVYYNTRTDDMSSLCGPVIDDV 344 Query: 227 KL 232 ++ Sbjct: 345 RV 346 >TAIR9_protein||AT1G29980.1 | Symbols: | INVOLVED IN: biological_process unknown; LOCATED IN: plasma membrane, anchored to membrane; EXPRESSED IN: 24 plant structures; EXPRESSED DURING: 13 growth stages; CONTAINS InterPro DOMAIN/s: Protein of unknown function DUF642 (InterPro:IPR006946), Galactose-binding like (InterPro:IPR008979); BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT2G34510.1); Has 180 Blast hits to 163 proteins in 15 species: Archae - 0; Bacteria - 10; Metazoa - 0; Fungi - 0; Plants - 170; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). | chr1:10503411-10505994 REVERSE Length = 408 Score = 62 bits (149), Expect = 2e-010 Identities = 27/62 (43%), Positives = 40/62 (64%) Frame = +2 Query: 47 FAGRNTVKVPYESKGKGGFKRAVLKFVSVSNRTRIMFLSTFYTMRSDDFSSLCGPVLDDV 226 FAG Y ++ F++A L F + ++RTR+ F S +Y R+DD SSLCGPV+DDV Sbjct: 321 FAGDQAQNFHYMAQANSSFEKAGLNFTAKADRTRVAFYSVYYNTRTDDMSSLCGPVIDDV 380 Query: 227 KL 232 ++ Sbjct: 381 RV 382 >TAIR9_protein||AT2G41810.1 | Symbols: | FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: endomembrane system; EXPRESSED IN: root; CONTAINS InterPro DOMAIN/s: Protein of unknown function DUF642 (InterPro:IPR006946), Galactose-binding like (InterPro:IPR008979); BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT2G41800.1); Has 161 Blast hits to 157 proteins in 12 species: Archae - 0; Bacteria - 2; Metazoa - 0; Fungi - 0; Plants - 159; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). | chr2:17439414-17441296 REVERSE Length = 371 Score = 62 bits (149), Expect = 2e-010 Identities = 32/62 (51%), Positives = 38/62 (61%) Frame = +2 Query: 47 FAGRNTVKVPYESKGKGGFKRAVLKFVSVSNRTRIMFLSTFYTMRSDDFSSLCGPVLDDV 226 FAG + KV +ES KG FK F + SNRTRI F S FY + DF LCGPVLD+V Sbjct: 305 FAGISAFKVTFESNDKGAFKVGRFAFRADSNRTRITFYSGFYHTKLHDFGHLCGPVLDNV 364 Query: 227 KL 232 + Sbjct: 365 SV 366 >TAIR9_protein||AT2G34510.1 | Symbols: | FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: anchored to membrane; EXPRESSED IN: 20 plant structures; EXPRESSED DURING: 14 growth stages; CONTAINS InterPro DOMAIN/s: Protein of unknown function DUF642 (InterPro:IPR006946), Galactose-binding like (InterPro:IPR008979); BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT1G29980.1); Has 177 Blast hits to 163 proteins in 15 species: Archae - 0; Bacteria - 10; Metazoa - 0; Fungi - 0; Plants - 167; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). | chr2:14544114-14546732 REVERSE Length = 402 Score = 62 bits (149), Expect = 2e-010 Identities = 28/62 (45%), Positives = 39/62 (62%) Frame = +2 Query: 47 FAGRNTVKVPYESKGKGGFKRAVLKFVSVSNRTRIMFLSTFYTMRSDDFSSLCGPVLDDV 226 FAG Y ++ F+R+ L F + + RTRI F S +Y R+DD +SLCGPV+DDV Sbjct: 317 FAGDQAQNFHYMAQANSSFERSELNFTAKAERTRIAFYSIYYNTRTDDMTSLCGPVIDDV 376 Query: 227 KL 232 K+ Sbjct: 377 KV 378 Database: TAIR9 protein Posted date: Wed Jul 08 15:16:08 2009 Number of letters in database: 13,468,323 Number of sequences in database: 33,410 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 1,658,669,864 Number of Sequences: 33410 Number of Extensions: 1658669864 Number of Successful Extensions: 92048679 Number of sequences better than 0.0: 0 |