BLASTX 7.6.2 Query= RU06752 /QuerySize=587 (586 letters) Database: TAIR9 protein; 33,410 sequences; 13,468,323 total letters Score E Sequences producing significant alignments: (bits) Value TAIR9_protein||AT4G38810.2 | Symbols: | calcium-binding EF hand... 115 3e-026 >TAIR9_protein||AT4G38810.2 | Symbols: | calcium-binding EF hand family protein | chr4:18115607-18118860 REVERSE Length = 376 Score = 115 bits (286), Expect = 3e-026 Identities = 54/70 (77%), Positives = 64/70 (91%) Frame = +1 Query: 376 EVLDGSDIMELVENKEVFSHFVDHKFEELDRDRDGQLSVNELQPAVADIGAALGLPVQGS 555 +VLDGSDI+ELVEN++VF FV+ KF++LD+D DG+LSV ELQPAVADIGAALGLP QG+ Sbjct: 13 QVLDGSDIVELVENEKVFDKFVEQKFQQLDQDEDGKLSVTELQPAVADIGAALGLPAQGT 72 Query: 556 SPDSDHIYSE 585 SPDSDHIYSE Sbjct: 73 SPDSDHIYSE 82 Database: TAIR9 protein Posted date: Wed Jul 08 15:16:08 2009 Number of letters in database: 13,468,323 Number of sequences in database: 33,410 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 1,658,669,864 Number of Sequences: 33410 Number of Extensions: 1658669864 Number of Successful Extensions: 92048679 Number of sequences better than 0.0: 0 |