BLASTX 7.6.2 Query= RU07147 /QuerySize=274 (273 letters) Database: TAIR9 protein; 33,410 sequences; 13,468,323 total letters Score E Sequences producing significant alignments: (bits) Value TAIR9_protein||AT1G27350.1 | Symbols: | FUNCTIONS IN: molecular... 85 8e-018 TAIR9_protein||AT1G27330.1 | Symbols: | FUNCTIONS IN: molecular... 85 8e-018 >TAIR9_protein||AT1G27350.1 | Symbols: | FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: cellular_component unknown; CONTAINS InterPro DOMAIN/s: Ribosome associated membrane RAMP4 (InterPro:IPR010580); BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT1G27330.1); Has 267 Blast hits to 267 proteins in 83 species: Archae - 0; Bacteria - 0; Metazoa - 183; Fungi - 0; Plants - 55; Viruses - 0; Other Eukaryotes - 29 (source: NCBI BLink). | chr1:9498319-9499303 REVERSE Length = 69 Score = 85 bits (208), Expect = 8e-018 Identities = 38/46 (82%), Positives = 43/46 (93%) Frame = +2 Query: 134 RRLADRKVERFEKNITKRGAVPETTAKKGKDYPVGPILLGFFIFVV 271 +RLADRK+E+F+KNI KRG VPETT KKGKDYPVGPILLGFF+FVV Sbjct: 5 KRLADRKIEKFDKNILKRGFVPETTTKKGKDYPVGPILLGFFVFVV 50 >TAIR9_protein||AT1G27330.1 | Symbols: | FUNCTIONS IN: molecular_function unknown; INVOLVED IN: response to oxidative stress; LOCATED IN: cellular_component unknown; EXPRESSED IN: male gametophyte, pollen tube; EXPRESSED DURING: L mature pollen stage, M germinated pollen stage; CONTAINS InterPro DOMAIN/s: Ribosome associated membrane RAMP4 (InterPro:IPR010580); BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT1G27350.1); Has 267 Blast hits to 267 proteins in 83 species: Archae - 0; Bacteria - 0; Metazoa - 183; Fungi - 0; Plants - 55; Viruses - 0; Other Eukaryotes - 29 (source: NCBI BLink). | chr1:9493064-9493898 FORWARD Length = 69 Score = 85 bits (208), Expect = 8e-018 Identities = 38/46 (82%), Positives = 43/46 (93%) Frame = +2 Query: 134 RRLADRKVERFEKNITKRGAVPETTAKKGKDYPVGPILLGFFIFVV 271 +RLADRK+E+F+KNI KRG VPETT KKGKDYPVGPILLGFF+FVV Sbjct: 5 KRLADRKIEKFDKNILKRGFVPETTTKKGKDYPVGPILLGFFVFVV 50 Database: TAIR9 protein Posted date: Wed Jul 08 15:16:08 2009 Number of letters in database: 13,468,323 Number of sequences in database: 33,410 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 1,781,210,414 Number of Sequences: 33410 Number of Extensions: 1781210414 Number of Successful Extensions: 102579658 Number of sequences better than 0.0: 0 |