BLASTX 7.6.2 Query= RU07222 /QuerySize=428 (427 letters) Database: TAIR9 protein; 33,410 sequences; 13,468,323 total letters Score E Sequences producing significant alignments: (bits) Value TAIR9_protein||AT5G63260.1 | Symbols: | zinc finger (CCCH-type)... 55 2e-008 TAIR9_protein||AT3G02830.1 | Symbols: ZFN1 | ZFN1 (ZINC FINGER P... 53 5e-008 TAIR9_protein||AT3G48440.1 | Symbols: | zinc finger (CCCH-type)... 52 1e-007 TAIR9_protein||AT5G16540.2 | Symbols: ZFN3 | ZFN3 (ZINC FINGER N... 50 4e-007 TAIR9_protein||AT5G16540.3 | Symbols: ZFN3 | ZFN3 (ZINC FINGER N... 50 4e-007 TAIR9_protein||AT5G16540.1 | Symbols: ZFN3 | ZFN3 (ZINC FINGER N... 50 4e-007 TAIR9_protein||AT5G18550.1 | Symbols: | nucleic acid binding / ... 49 1e-006 TAIR9_protein||AT3G06410.1 | Symbols: | nucleic acid binding / ... 47 3e-006 >TAIR9_protein||AT5G63260.1 | Symbols: | zinc finger (CCCH-type) family protein | chr5:25361900-25364453 FORWARD Length = 436 Score = 55 bits (130), Expect = 2e-008 Identities = 22/30 (73%), Positives = 25/30 (83%) Frame = -1 Query: 424 CTHYSRYGICKFGPACKFDHPLHLTSSTTS 335 CTHYSRYGICKFGPAC+FDH + T S +S Sbjct: 386 CTHYSRYGICKFGPACRFDHSIPPTFSPSS 415 >TAIR9_protein||AT3G02830.1 | Symbols: ZFN1 | ZFN1 (ZINC FINGER PROTEIN 1); DNA binding / nuclease/ nucleic acid binding | chr3:614075-615916 FORWARD Length = 398 Score = 53 bits (126), Expect = 5e-008 Identities = 30/73 (41%), Positives = 42/73 (57%), Gaps = 11/73 (15%) Frame = -1 Query: 424 CTHYSRYGICKFGPACKFDHPLHLTS--STTSGLDHQLPFS-------DLANTKEAGIAR 272 C Y+RYGICKFGP+CKFDHP+ + + +T S D + S ++ T++A A Sbjct: 326 CVFYTRYGICKFGPSCKFDHPMRVFTYDNTASETDEVVETSTGKSRRLSVSETRQA--AT 383 Query: 271 SRSGTDDTIQLQQ 233 + SG D TI Q Sbjct: 384 TSSGKDTTIDNTQ 396 >TAIR9_protein||AT3G48440.1 | Symbols: | zinc finger (CCCH-type) family protein | chr3:17941402-17943576 FORWARD Length = 449 Score = 52 bits (123), Expect = 1e-007 Identities = 21/30 (70%), Positives = 24/30 (80%) Frame = -1 Query: 424 CTHYSRYGICKFGPACKFDHPLHLTSSTTS 335 CT+YSRYGICKFGPAC+FDH + ST S Sbjct: 398 CTYYSRYGICKFGPACRFDHSVQPPYSTES 427 >TAIR9_protein||AT5G16540.2 | Symbols: ZFN3 | ZFN3 (ZINC FINGER NUCLEASE 3); DNA binding / nuclease/ nucleic acid binding | chr5:5403437-5405034 FORWARD Length = 369 Score = 50 bits (119), Expect = 4e-007 Identities = 18/24 (75%), Positives = 21/24 (87%) Frame = -1 Query: 424 CTHYSRYGICKFGPACKFDHPLHL 353 C YSRYGICKFGP+CKFDHP+ + Sbjct: 288 CVFYSRYGICKFGPSCKFDHPMRV 311 >TAIR9_protein||AT5G16540.3 | Symbols: ZFN3 | ZFN3 (ZINC FINGER NUCLEASE 3); DNA binding / nuclease/ nucleic acid binding | chr5:5403598-5405034 FORWARD Length = 355 Score = 50 bits (119), Expect = 4e-007 Identities = 18/24 (75%), Positives = 21/24 (87%) Frame = -1 Query: 424 CTHYSRYGICKFGPACKFDHPLHL 353 C YSRYGICKFGP+CKFDHP+ + Sbjct: 274 CVFYSRYGICKFGPSCKFDHPMRV 297 >TAIR9_protein||AT5G16540.1 | Symbols: ZFN3 | ZFN3 (ZINC FINGER NUCLEASE 3); DNA binding / nuclease/ nucleic acid binding | chr5:5403437-5405034 FORWARD Length = 376 Score = 50 bits (119), Expect = 4e-007 Identities = 18/24 (75%), Positives = 21/24 (87%) Frame = -1 Query: 424 CTHYSRYGICKFGPACKFDHPLHL 353 C YSRYGICKFGP+CKFDHP+ + Sbjct: 295 CVFYSRYGICKFGPSCKFDHPMRV 318 >TAIR9_protein||AT5G18550.1 | Symbols: | nucleic acid binding / zinc ion binding | chr5:6160515-6162729 FORWARD Length = 466 Score = 49 bits (115), Expect = 1e-006 Identities = 19/30 (63%), Positives = 25/30 (83%) Frame = -1 Query: 424 CTHYSRYGICKFGPACKFDHPLHLTSSTTS 335 CTH++++GICKFGPACKFDH L +S + S Sbjct: 351 CTHFAQHGICKFGPACKFDHSLGSSSLSYS 380 >TAIR9_protein||AT3G06410.1 | Symbols: | nucleic acid binding / zinc ion binding | chr3:1947471-1949528 REVERSE Length = 463 Score = 47 bits (111), Expect = 3e-006 Identities = 16/22 (72%), Positives = 21/22 (95%) Frame = -1 Query: 424 CTHYSRYGICKFGPACKFDHPL 359 CTH++++GICKFGPACKFDH + Sbjct: 359 CTHFAQHGICKFGPACKFDHSM 380 Database: TAIR9 protein Posted date: Wed Jul 08 15:16:08 2009 Number of letters in database: 13,468,323 Number of sequences in database: 33,410 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 1,781,210,414 Number of Sequences: 33410 Number of Extensions: 1781210414 Number of Successful Extensions: 102579658 Number of sequences better than 0.0: 0 |