BLASTX 7.6.2 Query= RU08863 /QuerySize=339 (338 letters) Database: TAIR9 protein; 33,410 sequences; 13,468,323 total letters Score E Sequences producing significant alignments: (bits) Value TAIR9_protein||AT2G17036.1 | Symbols: | F-box family protein | ... 48 8e-007 TAIR9_protein||AT2G17030.1 | Symbols: | F-box family protein | ... 47 1e-006 TAIR9_protein||AT3G25750.1 | Symbols: | F-box family protein | ... 47 2e-006 >TAIR9_protein||AT2G17036.1 | Symbols: | F-box family protein | chr2:7403856-7405219 FORWARD Length = 429 Score = 48 bits (113), Expect = 8e-007 Identities = 20/37 (54%), Positives = 27/37 (72%) Frame = -1 Query: 179 LQWCDLPKELWQMIGKFLETRVDVLRFRSVCSLWRSA 69 + W LPK+L +I K LE+ D+++FRSVCS WRSA Sbjct: 1 MDWATLPKDLLDLISKCLESSFDLIQFRSVCSSWRSA 37 >TAIR9_protein||AT2G17030.1 | Symbols: | F-box family protein | chr2:7399108-7400650 FORWARD Length = 408 Score = 47 bits (111), Expect = 1e-006 Identities = 20/37 (54%), Positives = 27/37 (72%) Frame = -1 Query: 179 LQWCDLPKELWQMIGKFLETRVDVLRFRSVCSLWRSA 69 + W LPK+L +I K LE+ D+++FRSVCS WRSA Sbjct: 2 VDWSTLPKDLLDLISKSLESSFDLIQFRSVCSSWRSA 38 >TAIR9_protein||AT3G25750.1 | Symbols: | F-box family protein | chr3:9400955-9402088 FORWARD Length = 349 Score = 47 bits (110), Expect = 2e-006 Identities = 20/39 (51%), Positives = 25/39 (64%) Frame = -1 Query: 182 KLQWCDLPKELWQMIGKFLETRVDVLRFRSVCSLWRSAV 66 K +W DLP+EL +I + +DVLR RS C WRSAV Sbjct: 3 KTEWSDLPEELLDLIANRYSSNIDVLRIRSTCKSWRSAV 41 Database: TAIR9 protein Posted date: Wed Jul 08 15:16:08 2009 Number of letters in database: 13,468,323 Number of sequences in database: 33,410 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 2,018,912,189 Number of Sequences: 33410 Number of Extensions: 2018912189 Number of Successful Extensions: 108904459 Number of sequences better than 0.0: 0 |