BLASTX 7.6.2 Query= RU08963 /QuerySize=411 (410 letters) Database: TAIR9 protein; 33,410 sequences; 13,468,323 total letters Score E Sequences producing significant alignments: (bits) Value TAIR9_protein||AT4G12590.1 | Symbols: | unknown protein | chr4:... 181 1e-046 >TAIR9_protein||AT4G12590.1 | Symbols: | unknown protein | chr4:7451291-7452976 REVERSE Length = 247 Score = 181 bits (459), Expect = 1e-046 Identities = 90/103 (87%), Positives = 96/103 (93%) Frame = -3 Query: 309 MAADLVLDTAIRDWVLIPLSVVMVLIGVLRYFVSKLMRSSQVPDAKIVKEGQLVIRARNL 130 MA DLVLDTAIRDWVLIPLSVVMVLIG+LRYFVSKLMRS+ PDAK+VKEGQ+VIRARNL Sbjct: 1 MAEDLVLDTAIRDWVLIPLSVVMVLIGILRYFVSKLMRSTPTPDAKMVKEGQVVIRARNL 60 Query: 129 RASANFIPPKSFRARRFYFSNEENGLLFVPKGQAQNPQAQMFS 1 + ANFIPPKSFRARRFYFSNEENGLL VPKG+AQNPQA MFS Sbjct: 61 KVGANFIPPKSFRARRFYFSNEENGLLHVPKGEAQNPQAAMFS 103 Database: TAIR9 protein Posted date: Wed Jul 08 15:16:08 2009 Number of letters in database: 13,468,323 Number of sequences in database: 33,410 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 2,018,912,189 Number of Sequences: 33410 Number of Extensions: 2018912189 Number of Successful Extensions: 108904459 Number of sequences better than 0.0: 0 |