BLASTX 7.6.2 Query= RU09203 /QuerySize=780 (779 letters) Database: TAIR9 protein; 33,410 sequences; 13,468,323 total letters Score E Sequences producing significant alignments: (bits) Value TAIR9_protein||ATCG00300.1 | Symbols: YCF9 | encodes PsbZ, which... 96 2e-020 >TAIR9_protein||ATCG00300.1 | Symbols: YCF9 | encodes PsbZ, which is a subunit of photosystem II. In Chlamydomonas, this protein has been shown to be essential in the interaction between PS II and the light harvesting complex II. | chrC:35751-35939 FORWARD Length = 63 Score = 96 bits (237), Expect = 2e-020 Identities = 48/63 (76%), Positives = 49/63 (77%) Frame = +1 Query: 88 MTIAFQLAVFXXXXXXXXXXXXVPVVFASPEGWSGNKNVVFSGTSLWIGLVFLVGILNSL 267 MTIAFQLAVF VPVVFASP+GWS NKNVVFSGTSLWIGLVFLVGILNSL Sbjct: 1 MTIAFQLAVFALIITSSILLISVPVVFASPDGWSSNKNVVFSGTSLWIGLVFLVGILNSL 60 Query: 268 IS* 276 IS* Sbjct: 61 IS* 63 Database: TAIR9 protein Posted date: Wed Jul 08 15:16:08 2009 Number of letters in database: 13,468,323 Number of sequences in database: 33,410 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 2,047,743,481 Number of Sequences: 33410 Number of Extensions: 2047743481 Number of Successful Extensions: 109010649 Number of sequences better than 0.0: 0 |