BLASTX 7.6.2 Query= RU09336 /QuerySize=366 (365 letters) Database: TAIR9 protein; 33,410 sequences; 13,468,323 total letters Score E Sequences producing significant alignments: (bits) Value TAIR9_protein||AT1G74120.1 | Symbols: | mitochondrial transcrip... 170 2e-043 >TAIR9_protein||AT1G74120.1 | Symbols: | mitochondrial transcription termination factor-related / mTERF-related | chr1:27871923-27873260 REVERSE Length = 446 Score = 170 bits (429), Expect = 2e-043 Identities = 80/119 (67%), Positives = 97/119 (81%) Frame = -3 Query: 360 RLKPLLCEFKDFGFGKDVIRREIVKEPRVLGMEFGEFSWCLEWLRTLKCREPIKEKIFSN 181 RLKPLL EF GF KD +++EI +EPRVLG+E GE CLE + TLKCRE I+ I S Sbjct: 217 RLKPLLDEFMKMGFSKDDVKKEIAREPRVLGLELGELPRCLELINTLKCREVIRVSIISE 276 Query: 180 GEFRAGFEVKLRVDCLCKHGLIRREAFEVLWKEPRSIIYKVEDIERKIEFLTHEMKFNI 4 G FRAGFEVKLRVDCLCK+GLIRR+AF+V+WKEPR I+Y++EDIE+KIEFLT+ M F+I Sbjct: 277 GAFRAGFEVKLRVDCLCKYGLIRRDAFKVVWKEPRVILYEIEDIEKKIEFLTNRMGFHI 335 Database: TAIR9 protein Posted date: Wed Jul 08 15:16:08 2009 Number of letters in database: 13,468,323 Number of sequences in database: 33,410 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 2,076,802,237 Number of Sequences: 33410 Number of Extensions: 2076802237 Number of Successful Extensions: 109077215 Number of sequences better than 0.0: 0 |