BLASTX 7.6.2 Query= RU09915 /QuerySize=585 (584 letters) Database: TAIR9 protein; 33,410 sequences; 13,468,323 total letters Score E Sequences producing significant alignments: (bits) Value TAIR9_protein||AT4G02750.1 | Symbols: | pentatricopeptide (PPR)... 64 8e-011 TAIR9_protein||AT5G48910.1 | Symbols: | pentatricopeptide (PPR)... 50 9e-007 >TAIR9_protein||AT4G02750.1 | Symbols: | pentatricopeptide (PPR) repeat-containing protein | chr4:1221116-1223461 REVERSE Length = 782 Score = 64 bits (153), Expect = 8e-011 Identities = 30/51 (58%), Positives = 39/51 (76%) Frame = -3 Query: 498 DSEVVKFNMEISTQMRNGQCEEALRLFNAMGWRSSVSYNAMISGYLANGKF 346 DS++ ++N+ IS+ MR G+C EALR+F M SSVSYN MISGYL NG+F Sbjct: 61 DSDIKEWNVAISSYMRTGRCNEALRVFKRMPRWSSVSYNGMISGYLRNGEF 111 >TAIR9_protein||AT5G48910.1 | Symbols: | pentatricopeptide (PPR) repeat-containing protein | chr5:19832969-19834909 REVERSE Length = 647 Score = 50 bits (118), Expect = 9e-007 Identities = 26/51 (50%), Positives = 32/51 (62%) Frame = -3 Query: 498 DSEVVKFNMEISTQMRNGQCEEALRLFNAMGWRSSVSYNAMISGYLANGKF 346 D E+V +N+ I MR G C+ A LF+ M RS VS+N MISGY NG F Sbjct: 205 DGEIVLWNVMIDGYMRLGDCKAARMLFDKMRQRSVVSWNTMISGYSLNGFF 255 Database: TAIR9 protein Posted date: Wed Jul 08 15:16:08 2009 Number of letters in database: 13,468,323 Number of sequences in database: 33,410 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 2,134,724,694 Number of Sequences: 33410 Number of Extensions: 2134724694 Number of Successful Extensions: 109177873 Number of sequences better than 0.0: 0 |