BLASTX 7.6.2 Query= RU10148 /QuerySize=652 (651 letters) Database: TAIR9 protein; 33,410 sequences; 13,468,323 total letters Score E Sequences producing significant alignments: (bits) Value TAIR9_protein||AT1G69980.1 | Symbols: | unknown protein | chr1:... 95 4e-020 >TAIR9_protein||AT1G69980.1 | Symbols: | unknown protein | chr1:26356559-26357647 REVERSE Length = 206 Score = 95 bits (234), Expect = 4e-020 Identities = 42/62 (67%), Positives = 46/62 (74%) Frame = +1 Query: 124 EEGEGIGSRTLLGLKETPHGTNSTFECSPNGPCVPCQYSEKNNEKYRCSETGYRIPLKCV 303 EE +G R LLG KETP G+N TF CSP+GPCV C SEK EKYRCSETGYRIP KC Sbjct: 37 EEIRSVGRRFLLGFKETPKGSNITFACSPSGPCVSCNSSEKRKEKYRCSETGYRIPFKCK 96 Query: 304 EI 309 E+ Sbjct: 97 EV 98 Score = 69 bits (168), Expect = 2e-012 Identities = 48/112 (42%), Positives = 64/112 (57%), Gaps = 9/112 (8%) Frame = +1 Query: 322 KDAKAKIGPKKSRSTLEVSHNISELHNAEELGTLLRHRSLLVDSSTEENDK-QAYITYRS 498 K+ + ++ K E ++ S +N EE T R+LL DSS K Q+Y TYRS Sbjct: 96 KEVREEVDAHKKNGEEETQNDQSN-NNDEEAKT----RNLLDDSSPATKVKSQSYKTYRS 150 Query: 499 CIPPVNEEKLSVLGFEVIVLCLLVISGSTAPPTKRQTATMAGFS---RIQSN 645 C+P +EEKLSVLGFE I+L L ++SG+ KRQT M G S R+Q N Sbjct: 151 CVPSADEEKLSVLGFESIMLGLFLLSGAAIYIRKRQTVPMLGVSSSGRLQGN 202 Database: TAIR9 protein Posted date: Wed Jul 08 15:16:08 2009 Number of letters in database: 13,468,323 Number of sequences in database: 33,410 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 2,134,724,694 Number of Sequences: 33410 Number of Extensions: 2134724694 Number of Successful Extensions: 109177873 Number of sequences better than 0.0: 0 |