BLASTX 7.6.2 Query= RU10567 /QuerySize=340 (339 letters) Database: TAIR9 protein; 33,410 sequences; 13,468,323 total letters Score E Sequences producing significant alignments: (bits) Value TAIR9_protein||AT2G32950.1 | Symbols: COP1, ATCOP1, DET340, FUS1... 63 3e-011 >TAIR9_protein||AT2G32950.1 | Symbols: COP1, ATCOP1, DET340, FUS1, EMB168 | COP1 (CONSTITUTIVE PHOTOMORPHOGENIC 1); protein binding / ubiquitin-protein ligase | chr2:13978000-13983282 FORWARD Length = 676 Score = 63 bits (151), Expect = 3e-011 Identities = 30/31 (96%) Frame = +3 Query: 3 FISAVCWKSDSPTMLTANSQGTIKVLVLAA* 95 FISAVCWKSDSPTMLTANSQGTIKVLVLAA* Sbjct: 646 FISAVCWKSDSPTMLTANSQGTIKVLVLAA* 676 Database: TAIR9 protein Posted date: Wed Jul 08 15:16:08 2009 Number of letters in database: 13,468,323 Number of sequences in database: 33,410 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 2,252,006,599 Number of Sequences: 33410 Number of Extensions: 2252006599 Number of Successful Extensions: 119374135 Number of sequences better than 0.0: 0 |