BLASTX 7.6.2 Query= RU10701 /QuerySize=450 (449 letters) Database: TAIR9 protein; 33,410 sequences; 13,468,323 total letters Score E Sequences producing significant alignments: (bits) Value TAIR9_protein||AT1G02070.1 | Symbols: | unknown protein | chr1:... 98 2e-021 TAIR9_protein||AT3G60520.1 | Symbols: | unknown protein | chr3:... 97 4e-021 >TAIR9_protein||AT1G02070.1 | Symbols: | unknown protein | chr1:370445-370947 REVERSE Length = 132 Score = 98 bits (243), Expect = 2e-021 Identities = 38/50 (76%), Positives = 42/50 (84%) Frame = +1 Query: 205 LQSVCCMCGDVGFPDKLFRCNKCRNRFQHSYCSNYYSEFAEPIELCDWCR 354 ++ VCCMCGDVGF DKLF C CR RFQHSYCSNYY +FAEP E+CDWCR Sbjct: 1 MERVCCMCGDVGFSDKLFSCGHCRCRFQHSYCSNYYGQFAEPTEICDWCR 50 >TAIR9_protein||AT3G60520.1 | Symbols: | unknown protein | chr3:22361751-22362467 REVERSE Length = 130 Score = 97 bits (240), Expect = 4e-021 Identities = 39/54 (72%), Positives = 46/54 (85%) Frame = +1 Query: 193 MVDRLQSVCCMCGDVGFPDKLFRCNKCRNRFQHSYCSNYYSEFAEPIELCDWCR 354 MVD + VCCMCGDVGF DKLF C+KC NRFQHSYCS+YY E A+PI++CDWC+ Sbjct: 1 MVDLERRVCCMCGDVGFFDKLFHCSKCLNRFQHSYCSSYYKEQADPIKICDWCQ 54 Database: TAIR9 protein Posted date: Wed Jul 08 15:16:08 2009 Number of letters in database: 13,468,323 Number of sequences in database: 33,410 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 2,252,006,599 Number of Sequences: 33410 Number of Extensions: 2252006599 Number of Successful Extensions: 119374135 Number of sequences better than 0.0: 0 |