BLASTX 7.6.2 Query= RU10766 /QuerySize=267 (266 letters) Database: TAIR9 protein; 33,410 sequences; 13,468,323 total letters Score E Sequences producing significant alignments: (bits) Value TAIR9_protein||AT5G05200.1 | Symbols: | ABC1 family protein | c... 55 9e-009 >TAIR9_protein||AT5G05200.1 | Symbols: | ABC1 family protein | chr5:1544206-1547082 REVERSE Length = 541 Score = 55 bits (130), Expect = 9e-009 Identities = 29/48 (60%), Positives = 36/48 (75%), Gaps = 8/48 (16%) Frame = +3 Query: 123 KGFTLLARYSQTQDLFSSRLQAWKFLLLSDSMENLPKLVEDIVRTSLS 266 KGF L A+YSQTQDLF+SRLQ+ +E LPKLVEDIV+TS++ Sbjct: 39 KGFVLTAQYSQTQDLFTSRLQS--------QIEKLPKLVEDIVQTSIN 78 Database: TAIR9 protein Posted date: Wed Jul 08 15:16:08 2009 Number of letters in database: 13,468,323 Number of sequences in database: 33,410 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 2,252,006,599 Number of Sequences: 33410 Number of Extensions: 2252006599 Number of Successful Extensions: 119374135 Number of sequences better than 0.0: 0 |