BLASTX 7.6.2 Query= RU12249 /QuerySize=662 (661 letters) Database: TAIR9 protein; 33,410 sequences; 13,468,323 total letters Score E Sequences producing significant alignments: (bits) Value TAIR9_protein||AT4G32490.1 | Symbols: | plastocyanin-like domai... 69 2e-012 TAIR9_protein||AT4G28365.1 | Symbols: | plastocyanin-like domai... 67 9e-012 TAIR9_protein||AT5G53870.1 | Symbols: | plastocyanin-like domai... 54 7e-008 >TAIR9_protein||AT4G32490.1 | Symbols: | plastocyanin-like domain-containing protein | chr4:15678811-15679556 REVERSE Length = 222 Score = 69 bits (167), Expect = 2e-012 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = +1 Query: 184 TEGYKFYVGGRDGWVLKPSESYNHWAERNRFLVNDTL 294 + G+KFYVGGRDGWVL PSE Y+HW+ RNRF VNDTL Sbjct: 26 SNGHKFYVGGRDGWVLTPSEDYSHWSHRNRFQVNDTL 62 >TAIR9_protein||AT4G28365.1 | Symbols: | plastocyanin-like domain-containing protein | chr4:14033012-14033688 REVERSE Length = 200 Score = 67 bits (162), Expect = 9e-012 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = +1 Query: 184 TEGYKFYVGGRDGWVLKPSESYNHWAERNRFLVNDTL 294 + GYKFYVGG+DGWV PSE Y+HW+ RNRF VNDTL Sbjct: 24 SNGYKFYVGGKDGWVPTPSEDYSHWSHRNRFQVNDTL 60 >TAIR9_protein||AT5G53870.1 | Symbols: | plastocyanin-like domain-containing protein | chr5:21870033-21871228 REVERSE Length = 371 Score = 54 bits (128), Expect = 7e-008 Identities = 22/39 (56%), Positives = 27/39 (69%) Frame = +1 Query: 178 SATEGYKFYVGGRDGWVLKPSESYNHWAERNRFLVNDTL 294 S + ++F VGG WV P E+YN WAERNRF VND+L Sbjct: 23 SVADAWRFNVGGNGAWVTNPQENYNTWAERNRFQVNDSL 61 Database: TAIR9 protein Posted date: Wed Jul 08 15:16:08 2009 Number of letters in database: 13,468,323 Number of sequences in database: 33,410 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 2,462,713,534 Number of Sequences: 33410 Number of Extensions: 2462713534 Number of Successful Extensions: 130446801 Number of sequences better than 0.0: 0 |