BLASTX 7.6.2 Query= RU12528 /QuerySize=483 (482 letters) Database: TAIR9 protein; 33,410 sequences; 13,468,323 total letters Score E Sequences producing significant alignments: (bits) Value TAIR9_protein||AT3G62630.1 | Symbols: | FUNCTIONS IN: molecular... 85 2e-017 >TAIR9_protein||AT3G62630.1 | Symbols: | FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: cellular_component unknown; EXPRESSED IN: 22 plant structures; EXPRESSED DURING: 14 growth stages; CONTAINS InterPro DOMAIN/s: Protein of unknown function DUF1645 (InterPro:IPR012442); BEST Arabidopsis thaliana protein match is: calmodulin-binding protein (TAIR:AT2G15760.1); Has 207 Blast hits to 197 proteins in 50 species: Archae - 3; Bacteria - 4; Metazoa - 52; Fungi - 9; Plants - 91; Viruses - 0; Other Eukaryotes - 48 (source: NCBI BLink). | chr3:23163937-23165079 REVERSE Length = 381 Score = 85 bits (209), Expect = 2e-017 Identities = 48/112 (42%), Positives = 59/112 (52%), Gaps = 4/112 (3%) Frame = +3 Query: 138 VGSLETTPXXXXXXXXXXXXXXXXKRWVFLKDFLHRSKSEGRSN--NKFWATISFSSSG- 308 V S ETTP K+W+FLKD LHRSKSEGR N KFW+ ISFS S Sbjct: 209 VPSAETTPSCSASSSRSSSYGRNSKKWIFLKDLLHRSKSEGRGNGKEKFWSNISFSPSNF 268 Query: 309 KEKKPMKGGSQKESLSLGTEPATQKAKGASGSAPGKK-PVAGKPANGVGKRR 461 K+KK +++ + + A + K P KK PV GKP NG+ KRR Sbjct: 269 KDKKLKSSQLEEKPIQETVDAAVESKKQKQKQPPAKKAPVNGKPTNGIAKRR 320 Database: TAIR9 protein Posted date: Wed Jul 08 15:16:08 2009 Number of letters in database: 13,468,323 Number of sequences in database: 33,410 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 2,491,849,528 Number of Sequences: 33410 Number of Extensions: 2491849528 Number of Successful Extensions: 130483807 Number of sequences better than 0.0: 0 |