BLASTX 7.6.2 Query= RU13731 /QuerySize=295 (294 letters) Database: TAIR9 protein; 33,410 sequences; 13,468,323 total letters Score E Sequences producing significant alignments: (bits) Value TAIR9_protein||AT1G02330.1 | Symbols: | FUNCTIONS IN: molecular... 112 5e-026 >TAIR9_protein||AT1G02330.1 | Symbols: | FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: cellular_component unknown; EXPRESSED IN: 23 plant structures; EXPRESSED DURING: 15 growth stages; CONTAINS InterPro DOMAIN/s: Hepatocellular carcinoma-associated antigen 59 (InterPro:IPR010756); Has 1111 Blast hits to 862 proteins in 155 species: Archae - 2; Bacteria - 54; Metazoa - 381; Fungi - 93; Plants - 45; Viruses - 5; Other Eukaryotes - 531 (source: NCBI BLink). | chr1:462202-463521 REVERSE Length = 280 Score = 112 bits (279), Expect = 5e-026 Identities = 51/67 (76%), Positives = 62/67 (92%) Frame = -1 Query: 201 EDPNMLSFIEREIAKKKGKKLEAPDEVENELQRAEDELYKIPDHLKVKKRNSEESSTQWT 22 EDPNM+ +IE+E+AKK+G+ ++ +EVENEL+R EDELYKIPDHLKVKKR+SEESSTQWT Sbjct: 97 EDPNMVKYIEQELAKKRGRNIDDAEEVENELKRVEDELYKIPDHLKVKKRSSEESSTQWT 156 Query: 21 TGIAEVQ 1 TGIAEVQ Sbjct: 157 TGIAEVQ 163 Database: TAIR9 protein Posted date: Wed Jul 08 15:16:08 2009 Number of letters in database: 13,468,323 Number of sequences in database: 33,410 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 2,638,211,360 Number of Sequences: 33410 Number of Extensions: 2638211360 Number of Successful Extensions: 136195546 Number of sequences better than 0.0: 0 |