BLASTX 7.6.2 Query= RU13744 /QuerySize=182 (181 letters) Database: TAIR9 protein; 33,410 sequences; 13,468,323 total letters Score E Sequences producing significant alignments: (bits) Value TAIR9_protein||AT1G26580.1 | Symbols: | FUNCTIONS IN: molecular... 81 1e-016 TAIR9_protein||AT2G03470.1 | Symbols: | myb family transcriptio... 79 5e-016 TAIR9_protein||AT2G03470.2 | Symbols: | myb family transcriptio... 79 5e-016 TAIR9_protein||AT1G13880.1 | Symbols: | ELM2 domain-containing ... 77 3e-015 TAIR9_protein||AT4G11400.1 | Symbols: | ARID/BRIGHT DNA-binding... 56 5e-009 >TAIR9_protein||AT1G26580.1 | Symbols: | FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: cellular_component unknown; EXPRESSED IN: 24 plant structures; EXPRESSED DURING: 15 growth stages; BEST Arabidopsis thaliana protein match is: myb family transcription factor / ELM2 domain-containing protein (TAIR:AT2G03470.1); Has 82 Blast hits to 82 proteins in 12 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 4; Plants - 78; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). | chr1:9185620-9187213 FORWARD Length = 494 Score = 81 bits (198), Expect = 1e-016 Identities = 34/53 (64%), Positives = 44/53 (83%) Frame = -3 Query: 173 KWSEEEEHLFHDVVLSNPASLGKNFWHNLSVAFPSRTHKDVVSYYFNVFMLRR 15 KWS+E+ LFH+VV SNP +LG+NFW +L AF SRT K++VS+YFNVF+LRR Sbjct: 250 KWSDEDAQLFHEVVYSNPVTLGQNFWRHLEAAFCSRTQKEIVSFYFNVFVLRR 302 >TAIR9_protein||AT2G03470.1 | Symbols: | myb family transcription factor / ELM2 domain-containing protein | chr2:1045694-1047130 REVERSE Length = 451 Score = 79 bits (193), Expect = 5e-016 Identities = 36/55 (65%), Positives = 42/55 (76%) Frame = -3 Query: 179 ADKWSEEEEHLFHDVVLSNPASLGKNFWHNLSVAFPSRTHKDVVSYYFNVFMLRR 15 A W+EEEE LFH VV SNP S G++FW L FPSRT K++VSYYFNVF+LRR Sbjct: 224 ASLWTEEEEDLFHKVVYSNPFSAGRDFWKQLKGTFPSRTMKELVSYYFNVFILRR 278 >TAIR9_protein||AT2G03470.2 | Symbols: | myb family transcription factor / ELM2 domain-containing protein | chr2:1045694-1047130 REVERSE Length = 450 Score = 79 bits (193), Expect = 5e-016 Identities = 36/55 (65%), Positives = 42/55 (76%) Frame = -3 Query: 179 ADKWSEEEEHLFHDVVLSNPASLGKNFWHNLSVAFPSRTHKDVVSYYFNVFMLRR 15 A W+EEEE LFH VV SNP S G++FW L FPSRT K++VSYYFNVF+LRR Sbjct: 223 ASLWTEEEEDLFHKVVYSNPFSAGRDFWKQLKGTFPSRTMKELVSYYFNVFILRR 277 >TAIR9_protein||AT1G13880.1 | Symbols: | ELM2 domain-containing protein | chr1:4749603-4750967 FORWARD Length = 425 Score = 77 bits (187), Expect = 3e-015 Identities = 33/55 (60%), Positives = 45/55 (81%) Frame = -3 Query: 179 ADKWSEEEEHLFHDVVLSNPASLGKNFWHNLSVAFPSRTHKDVVSYYFNVFMLRR 15 A + +E+EE LFH++V SNP S+ ++FW +L AFPSRT K++VSYYFNVF+LRR Sbjct: 230 AARLTEDEEDLFHEIVYSNPVSMDRDFWKHLKSAFPSRTMKEIVSYYFNVFILRR 284 >TAIR9_protein||AT4G11400.1 | Symbols: | ARID/BRIGHT DNA-binding domain-containing protein / ELM2 domain-containing protein / Myb-like DNA-binding domain-containing protein | chr4:6938717-6940539 FORWARD Length = 574 Score = 56 bits (133), Expect = 5e-009 Identities = 23/53 (43%), Positives = 37/53 (69%), Gaps = 4/53 (7%) Frame = -3 Query: 173 KWSEEEEHLFHDVVLSNPASLGKNFWHNLSVAFPSRTHKDVVSYYFNVFMLRR 15 +W+EEEE F D+++++P S FW N + FP + +++VSYYFNVF++ R Sbjct: 474 RWTEEEEKRFKDMIIADPQS----FWTNAAKNFPKKKREELVSYYFNVFLINR 522 Database: TAIR9 protein Posted date: Wed Jul 08 15:16:08 2009 Number of letters in database: 13,468,323 Number of sequences in database: 33,410 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 2,638,211,360 Number of Sequences: 33410 Number of Extensions: 2638211360 Number of Successful Extensions: 136195546 Number of sequences better than 0.0: 0 |