BLASTX 7.6.2 Query= RU14140 /QuerySize=230 (229 letters) Database: TAIR9 protein; 33,410 sequences; 13,468,323 total letters Score E Sequences producing significant alignments: (bits) Value TAIR9_protein||AT1G08520.1 | Symbols: PDE166, CHLD | CHLD; ATP b... 127 1e-030 >TAIR9_protein||AT1G08520.1 | Symbols: PDE166, CHLD | CHLD; ATP binding / magnesium chelatase/ nucleoside-triphosphatase/ nucleotide binding | chr1:2696538-2700819 FORWARD Length = 761 Score = 127 bits (319), Expect = 1e-030 Identities = 65/76 (85%), Positives = 70/76 (92%), Gaps = 2/76 (2%) Frame = +1 Query: 1 ANISLKRSNDPEAAAAATDVPKPSAKELKDEILEVAGKIYKAGMSLLVIDTENKFVSTGF 180 ANI+LKRS DPE + A D P+P++KELKDEILEVAGKIYKAGMSLLVIDTENKFVSTGF Sbjct: 666 ANITLKRSTDPE--SIAPDAPRPTSKELKDEILEVAGKIYKAGMSLLVIDTENKFVSTGF 723 Query: 181 AKEIARVAQGKYYYLP 228 AKEIARVAQGKYYYLP Sbjct: 724 AKEIARVAQGKYYYLP 739 Database: TAIR9 protein Posted date: Wed Jul 08 15:16:08 2009 Number of letters in database: 13,468,323 Number of sequences in database: 33,410 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 2,667,644,212 Number of Sequences: 33410 Number of Extensions: 2667644212 Number of Successful Extensions: 136241388 Number of sequences better than 0.0: 0 |