BLASTX 7.6.2 Query= RU14262 /QuerySize=453 (452 letters) Database: TAIR9 protein; 33,410 sequences; 13,468,323 total letters Score E Sequences producing significant alignments: (bits) Value TAIR9_protein||AT5G54470.1 | Symbols: | zinc finger (B-box type... 49 1e-006 TAIR9_protein||AT4G27310.1 | Symbols: | zinc finger (B-box type... 46 8e-006 >TAIR9_protein||AT5G54470.1 | Symbols: | zinc finger (B-box type) family protein | chr5:22114584-22115315 REVERSE Length = 216 Score = 49 bits (115), Expect = 1e-006 Identities = 19/32 (59%), Positives = 23/32 (71%) Frame = -1 Query: 452 RVLLCHVCQSQTPWTSCGAKLTPTVSVCQSCV 357 R LLC CQS TPW + G L PTVS+C+SC+ Sbjct: 44 RCLLCSACQSHTPWKASGLNLGPTVSICESCL 75 >TAIR9_protein||AT4G27310.1 | Symbols: | zinc finger (B-box type) family protein | chr4:13675853-13676616 FORWARD Length = 224 Score = 46 bits (108), Expect = 8e-006 Identities = 33/71 (46%), Positives = 41/71 (57%), Gaps = 13/71 (18%) Frame = -1 Query: 221 NQVVPWSCCSYSPAQRPPAVSGSDSE----AEISVSKRLRENVDVDYSDDEVGFDGTSSF 54 NQVVPWS + AQ PP +S S S+ ++ R REN D+ SDDE+ G+SS Sbjct: 151 NQVVPWS----AAAQVPPVMSSSSSDGGSGGSVTKRTRARENSDLLCSDDEI---GSSSA 203 Query: 53 GGS--MRPLKR 27 GS RPLKR Sbjct: 204 QGSNYSRPLKR 214 Database: TAIR9 protein Posted date: Wed Jul 08 15:16:08 2009 Number of letters in database: 13,468,323 Number of sequences in database: 33,410 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 2,696,939,967 Number of Sequences: 33410 Number of Extensions: 2696939967 Number of Successful Extensions: 136271816 Number of sequences better than 0.0: 0 |