BLASTX 7.6.2 Query= RU14516 /QuerySize=204 (203 letters) Database: TAIR9 protein; 33,410 sequences; 13,468,323 total letters Score E Sequences producing significant alignments: (bits) Value TAIR9_protein||AT5G44640.1 | Symbols: BGLU13 | BGLU13 (BETA GLUC... 56 3e-009 TAIR9_protein||AT5G42260.1 | Symbols: BGLU12 | BGLU12 (BETA GLUC... 56 3e-009 TAIR9_protein||AT2G25630.1 | Symbols: BGLU14 | BGLU14 (BETA GLUC... 52 6e-008 TAIR9_protein||AT2G44480.1 | Symbols: BGLU17 | BGLU17 (BETA GLUC... 52 8e-008 TAIR9_protein||AT2G44450.1 | Symbols: BGLU15 | BGLU15 (BETA GLUC... 51 1e-007 TAIR9_protein||AT3G60130.1 | Symbols: BGLU16 | BGLU16 (BETA GLUC... 51 1e-007 TAIR9_protein||AT1G02850.1 | Symbols: BGLU11 | BGLU11 (BETA GLUC... 50 2e-007 TAIR9_protein||AT1G02850.3 | Symbols: BGLU11 | BGLU11 (BETA GLUC... 50 2e-007 TAIR9_protein||AT1G02850.2 | Symbols: BGLU11 | BGLU11 (BETA GLUC... 50 2e-007 TAIR9_protein||AT1G02850.4 | Symbols: BGLU11 | BGLU11 (BETA GLUC... 50 2e-007 TAIR9_protein||AT1G02850.5 | Symbols: BGLU11 | BGLU11 (BETA GLUC... 50 2e-007 TAIR9_protein||AT3G18070.1 | Symbols: BGLU43 | BGLU43 (BETA GLUC... 50 2e-007 TAIR9_protein||AT3G18070.2 | Symbols: BGLU43 | BGLU43 (BETA GLUC... 50 2e-007 TAIR9_protein||AT3G62750.1 | Symbols: BGLU8 | BGLU8 (BETA GLUCOS... 50 2e-007 TAIR9_protein||AT1G60090.1 | Symbols: BGLU4 | BGLU4 (BETA GLUCOS... 49 5e-007 TAIR9_protein||AT3G18080.1 | Symbols: BGLU44 | BGLU44 (B-S GLUCO... 49 5e-007 TAIR9_protein||AT5G24550.1 | Symbols: BGLU32 | BGLU32 (BETA GLUC... 47 2e-006 TAIR9_protein||AT1G45191.2 | Symbols: BGLU1 | BGLU1 (BETA GLUCOS... 47 2e-006 TAIR9_protein||AT3G03640.1 | Symbols: GLUC, BGLU25 | BGLU25 (BET... 46 5e-006 TAIR9_protein||AT1G75940.1 | Symbols: ATA27, BGLU20 | ATA27; cat... 45 8e-006 >TAIR9_protein||AT5G44640.1 | Symbols: BGLU13 | BGLU13 (BETA GLUCOSIDASE 13); catalytic/ cation binding / hydrolase, hydrolyzing O-glycosyl compounds | chr5:18011146-18012669 FORWARD Length = 508 Score = 56 bits (134), Expect = 3e-009 Identities = 26/42 (61%), Positives = 30/42 (71%), Gaps = 1/42 (2%) Frame = -2 Query: 124 RHYSIP-FNRSSFPASFIFGAGSAAYQTEGAAHIHGKGPSIW 2 +H S P RS FP FIFGA ++AYQ EGAAH G+GPSIW Sbjct: 24 KHSSTPKLRRSDFPKDFIFGAATSAYQVEGAAHEDGRGPSIW 65 >TAIR9_protein||AT5G42260.1 | Symbols: BGLU12 | BGLU12 (BETA GLUCOSIDASE 12); catalytic/ cation binding / hydrolase, hydrolyzing O-glycosyl compounds | chr5:16898712-16900235 FORWARD Length = 508 Score = 56 bits (134), Expect = 3e-009 Identities = 26/42 (61%), Positives = 30/42 (71%), Gaps = 1/42 (2%) Frame = -2 Query: 124 RHYSIP-FNRSSFPASFIFGAGSAAYQTEGAAHIHGKGPSIW 2 +H S P RS FP FIFGA ++AYQ EGAAH G+GPSIW Sbjct: 24 KHSSTPKLRRSDFPEDFIFGAATSAYQVEGAAHEDGRGPSIW 65 >TAIR9_protein||AT2G25630.1 | Symbols: BGLU14 | BGLU14 (BETA GLUCOSIDASE 14); catalytic/ cation binding / hydrolase, hydrolyzing O-glycosyl compounds | chr2:10908360-10909880 FORWARD Length = 490 Score = 52 bits (123), Expect = 6e-008 Identities = 24/42 (57%), Positives = 29/42 (69%), Gaps = 1/42 (2%) Frame = -2 Query: 124 RHYSIP-FNRSSFPASFIFGAGSAAYQTEGAAHIHGKGPSIW 2 RH S P ++ FP FIFGA ++AYQ EGAA G+GPSIW Sbjct: 23 RHSSTPKLRKTDFPEDFIFGAATSAYQVEGAAQEDGRGPSIW 64 >TAIR9_protein||AT2G44480.1 | Symbols: BGLU17 | BGLU17 (BETA GLUCOSIDASE 17); catalytic/ cation binding / hydrolase, hydrolyzing O-glycosyl compounds | chr2:18359780-18363001 FORWARD Length = 518 Score = 52 bits (122), Expect = 8e-008 Identities = 23/38 (60%), Positives = 28/38 (73%) Frame = -2 Query: 115 SIPFNRSSFPASFIFGAGSAAYQTEGAAHIHGKGPSIW 2 S RSSFP F FGA S+AYQ+EGAA++ G+ PSIW Sbjct: 32 STSLQRSSFPQDFRFGAASSAYQSEGAANVDGREPSIW 69 >TAIR9_protein||AT2G44450.1 | Symbols: BGLU15 | BGLU15 (BETA GLUCOSIDASE 15); catalytic/ cation binding / hydrolase, hydrolyzing O-glycosyl compounds | chr2:18340966-18343744 FORWARD Length = 507 Score = 51 bits (121), Expect = 1e-007 Identities = 21/33 (63%), Positives = 25/33 (75%) Frame = -2 Query: 100 RSSFPASFIFGAGSAAYQTEGAAHIHGKGPSIW 2 RS FP FIFG+ ++AYQ EG AH G+GPSIW Sbjct: 33 RSDFPEDFIFGSATSAYQVEGGAHEDGRGPSIW 65 >TAIR9_protein||AT3G60130.1 | Symbols: BGLU16 | BGLU16 (BETA GLUCOSIDASE 16); catalytic/ cation binding / hydrolase, hydrolyzing O-glycosyl compounds | chr3:22210343-22213650 FORWARD Length = 515 Score = 51 bits (121), Expect = 1e-007 Identities = 22/42 (52%), Positives = 30/42 (71%), Gaps = 1/42 (2%) Frame = -2 Query: 124 RHYSIP-FNRSSFPASFIFGAGSAAYQTEGAAHIHGKGPSIW 2 +H + P R+ FP F+FG+ ++AYQ EGAAH G+GPSIW Sbjct: 23 KHSTRPRLRRNDFPQDFVFGSATSAYQCEGAAHEDGRGPSIW 64 >TAIR9_protein||AT1G02850.1 | Symbols: BGLU11 | BGLU11 (BETA GLUCOSIDASE 11); catalytic/ cation binding / hydrolase, hydrolyzing O-glycosyl compounds | chr1:630569-633085 FORWARD Length = 471 Score = 50 bits (119), Expect = 2e-007 Identities = 20/38 (52%), Positives = 29/38 (76%) Frame = -2 Query: 115 SIPFNRSSFPASFIFGAGSAAYQTEGAAHIHGKGPSIW 2 S+ ++R+ FP F+FG+G++AYQ EGAA G+ PSIW Sbjct: 23 SLKYSRNDFPPGFVFGSGTSAYQVEGAADEDGRTPSIW 60 >TAIR9_protein||AT1G02850.3 | Symbols: BGLU11 | BGLU11 (BETA GLUCOSIDASE 11); catalytic/ cation binding / hydrolase, hydrolyzing O-glycosyl compounds | chr1:630569-633085 FORWARD Length = 474 Score = 50 bits (119), Expect = 2e-007 Identities = 20/38 (52%), Positives = 29/38 (76%) Frame = -2 Query: 115 SIPFNRSSFPASFIFGAGSAAYQTEGAAHIHGKGPSIW 2 S+ ++R+ FP F+FG+G++AYQ EGAA G+ PSIW Sbjct: 23 SLKYSRNDFPPGFVFGSGTSAYQVEGAADEDGRTPSIW 60 >TAIR9_protein||AT1G02850.2 | Symbols: BGLU11 | BGLU11 (BETA GLUCOSIDASE 11); hydrolase, hydrolyzing O-glycosyl compounds | chr1:630569-633085 FORWARD Length = 498 Score = 50 bits (119), Expect = 2e-007 Identities = 20/38 (52%), Positives = 29/38 (76%) Frame = -2 Query: 115 SIPFNRSSFPASFIFGAGSAAYQTEGAAHIHGKGPSIW 2 S+ ++R+ FP F+FG+G++AYQ EGAA G+ PSIW Sbjct: 23 SLKYSRNDFPPGFVFGSGTSAYQVEGAADEDGRTPSIW 60 >TAIR9_protein||AT1G02850.4 | Symbols: BGLU11 | BGLU11 (BETA GLUCOSIDASE 11); catalytic/ cation binding / hydrolase, hydrolyzing O-glycosyl compounds | chr1:630569-633085 FORWARD Length = 522 Score = 50 bits (119), Expect = 2e-007 Identities = 20/38 (52%), Positives = 29/38 (76%) Frame = -2 Query: 115 SIPFNRSSFPASFIFGAGSAAYQTEGAAHIHGKGPSIW 2 S+ ++R+ FP F+FG+G++AYQ EGAA G+ PSIW Sbjct: 23 SLKYSRNDFPPGFVFGSGTSAYQVEGAADEDGRTPSIW 60 >TAIR9_protein||AT1G02850.5 | Symbols: BGLU11 | BGLU11 (BETA GLUCOSIDASE 11); catalytic/ cation binding / hydrolase, hydrolyzing O-glycosyl compounds | chr1:630569-633085 FORWARD Length = 521 Score = 50 bits (119), Expect = 2e-007 Identities = 20/38 (52%), Positives = 29/38 (76%) Frame = -2 Query: 115 SIPFNRSSFPASFIFGAGSAAYQTEGAAHIHGKGPSIW 2 S+ ++R+ FP F+FG+G++AYQ EGAA G+ PSIW Sbjct: 23 SLKYSRNDFPPGFVFGSGTSAYQVEGAADEDGRTPSIW 60 >TAIR9_protein||AT3G18070.1 | Symbols: BGLU43 | BGLU43 (BETA GLUCOSIDASE 43); catalytic/ cation binding / hydrolase, hydrolyzing O-glycosyl compounds | chr3:6187294-6189947 FORWARD Length = 502 Score = 50 bits (119), Expect = 2e-007 Identities = 20/34 (58%), Positives = 24/34 (70%) Frame = -2 Query: 103 NRSSFPASFIFGAGSAAYQTEGAAHIHGKGPSIW 2 NR SFP F+FG ++AYQ EG H G+GPSIW Sbjct: 31 NRKSFPEGFLFGTATSAYQVEGETHQDGRGPSIW 64 >TAIR9_protein||AT3G18070.2 | Symbols: BGLU43 | BGLU43 (BETA GLUCOSIDASE 43); catalytic/ cation binding / hydrolase, hydrolyzing O-glycosyl compounds | chr3:6187294-6189947 FORWARD Length = 425 Score = 50 bits (119), Expect = 2e-007 Identities = 20/34 (58%), Positives = 24/34 (70%) Frame = -2 Query: 103 NRSSFPASFIFGAGSAAYQTEGAAHIHGKGPSIW 2 NR SFP F+FG ++AYQ EG H G+GPSIW Sbjct: 31 NRKSFPEGFLFGTATSAYQVEGETHQDGRGPSIW 64 >TAIR9_protein||AT3G62750.1 | Symbols: BGLU8 | BGLU8 (BETA GLUCOSIDASE 8); catalytic/ cation binding / hydrolase, hydrolyzing O-glycosyl compounds | chr3:23214375-23216900 FORWARD Length = 498 Score = 50 bits (118), Expect = 2e-007 Identities = 21/39 (53%), Positives = 28/39 (71%) Frame = -2 Query: 118 YSIPFNRSSFPASFIFGAGSAAYQTEGAAHIHGKGPSIW 2 Y F R+ FP F+FGAG++AYQ EGAA+ G+ PS+W Sbjct: 19 YIDAFTRNDFPEDFLFGAGTSAYQWEGAANEDGRTPSVW 57 >TAIR9_protein||AT1G60090.1 | Symbols: BGLU4 | BGLU4 (BETA GLUCOSIDASE 4); catalytic/ cation binding / hydrolase, hydrolyzing O-glycosyl compounds | chr1:22155582-22158065 FORWARD Length = 513 Score = 49 bits (115), Expect = 5e-007 Identities = 20/35 (57%), Positives = 27/35 (77%) Frame = -2 Query: 106 FNRSSFPASFIFGAGSAAYQTEGAAHIHGKGPSIW 2 F+RS +P F+FGAG++AYQ EGAA G+ PS+W Sbjct: 24 FSRSDYPEGFVFGAGTSAYQWEGAAAEDGRKPSLW 58 >TAIR9_protein||AT3G18080.1 | Symbols: BGLU44 | BGLU44 (B-S GLUCOSIDASE 44); (R)-amygdalin beta-glucosidase/ 4-methylumbelliferyl-beta-D-glucopyranoside beta-glucosidase/ beta-gentiobiose beta-glucosidase/ cellobiose glucosidase/ esculin beta-glucosidase/ hydrolase, hydrolyzing O-glycosyl compounds | chr3:6191586-6194124 FORWARD Length = 513 Score = 49 bits (115), Expect = 5e-007 Identities = 19/34 (55%), Positives = 24/34 (70%) Frame = -2 Query: 103 NRSSFPASFIFGAGSAAYQTEGAAHIHGKGPSIW 2 +R SFP F+FG ++AYQ EG H G+GPSIW Sbjct: 40 SRQSFPKGFVFGTATSAYQVEGETHQDGRGPSIW 73 >TAIR9_protein||AT5G24550.1 | Symbols: BGLU32 | BGLU32 (BETA GLUCOSIDASE 32); catalytic/ cation binding / hydrolase, hydrolyzing O-glycosyl compounds | chr5:8392059-8395302 REVERSE Length = 535 Score = 47 bits (111), Expect = 2e-006 Identities = 22/41 (53%), Positives = 25/41 (60%) Frame = -2 Query: 124 RHYSIPFNRSSFPASFIFGAGSAAYQTEGAAHIHGKGPSIW 2 R + P NR SFP F FG S+AYQ EGA G+ PSIW Sbjct: 26 RFSTTPLNRYSFPPHFDFGVASSAYQYEGAVEEGGRSPSIW 66 >TAIR9_protein||AT1G45191.2 | Symbols: BGLU1 | BGLU1 (BETA GLUCOSIDASE 1); catalytic/ cation binding / hydrolase, hydrolyzing O-glycosyl compounds | chr1:17116044-17119076 FORWARD Length = 488 Score = 47 bits (110), Expect = 2e-006 Identities = 19/35 (54%), Positives = 25/35 (71%) Frame = -2 Query: 106 FNRSSFPASFIFGAGSAAYQTEGAAHIHGKGPSIW 2 ++RS FP F+FGAG +AYQ EGA G+ PS+W Sbjct: 29 YSRSDFPEGFVFGAGISAYQWEGAVDEDGRKPSVW 63 >TAIR9_protein||AT3G03640.1 | Symbols: GLUC, BGLU25 | BGLU25 (BETA GLUCOSIDASE 25); catalytic/ cation binding / hydrolase, hydrolyzing O-glycosyl compounds | chr3:881028-884028 FORWARD Length = 532 Score = 46 bits (107), Expect = 5e-006 Identities = 21/38 (55%), Positives = 26/38 (68%) Frame = -2 Query: 115 SIPFNRSSFPASFIFGAGSAAYQTEGAAHIHGKGPSIW 2 S F R SFP F+FGA ++A+Q EGAA G+G SIW Sbjct: 31 SSTFGRGSFPDGFLFGATTSAFQHEGAAEEGGRGSSIW 68 >TAIR9_protein||AT1G75940.1 | Symbols: ATA27, BGLU20 | ATA27; catalytic/ cation binding / hydrolase, hydrolyzing O-glycosyl compounds | chr1:28511198-28514044 FORWARD Length = 536 Score = 45 bits (105), Expect = 8e-006 Identities = 19/37 (51%), Positives = 26/37 (70%) Frame = -2 Query: 112 IPFNRSSFPASFIFGAGSAAYQTEGAAHIHGKGPSIW 2 I F R++FP FIFG +AA+Q EGA + +GPS+W Sbjct: 35 IHFTRANFPKGFIFGTATAAFQVEGAVNEGCRGPSMW 71 Database: TAIR9 protein Posted date: Wed Jul 08 15:16:08 2009 Number of letters in database: 13,468,323 Number of sequences in database: 33,410 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 2,696,939,967 Number of Sequences: 33410 Number of Extensions: 2696939967 Number of Successful Extensions: 136271816 Number of sequences better than 0.0: 0 |