BLASTX 7.6.2 Query= RU14742 /QuerySize=162 (161 letters) Database: TAIR9 protein; 33,410 sequences; 13,468,323 total letters Score E Sequences producing significant alignments: (bits) Value TAIR9_protein||AT1G50410.1 | Symbols: | SNF2 domain-containing ... 112 4e-026 TAIR9_protein||AT1G61140.1 | Symbols: EDA16 | EDA16 (embryo sac ... 106 4e-024 TAIR9_protein||AT1G61140.2 | Symbols: EDA16 | EDA16 (embryo sac ... 106 4e-024 TAIR9_protein||AT1G61140.3 | Symbols: EDA16 | EDA16 (embryo sac ... 106 4e-024 TAIR9_protein||AT3G20010.1 | Symbols: | SNF2 domain-containing ... 102 4e-023 TAIR9_protein||AT1G11100.1 | Symbols: | SNF2 domain-containing ... 92 6e-020 TAIR9_protein||AT3G16600.1 | Symbols: | SNF2 domain-containing ... 92 6e-020 TAIR9_protein||AT5G22750.1 | Symbols: RAD5 | RAD5; ATP binding /... 61 1e-010 TAIR9_protein||AT1G05120.1 | Symbols: | SNF2 domain-containing ... 57 2e-009 TAIR9_protein||AT5G05130.1 | Symbols: | SNF2 domain-containing ... 54 2e-008 TAIR9_protein||AT5G43530.1 | Symbols: | SNF2 domain-containing ... 53 4e-008 TAIR9_protein||AT1G02670.1 | Symbols: | DNA repair protein, put... 49 4e-007 TAIR9_protein||AT2G40770.1 | Symbols: | ATP binding / DNA bindi... 45 6e-006 >TAIR9_protein||AT1G50410.1 | Symbols: | SNF2 domain-containing protein / helicase domain-containing protein / RING finger domain-containing protein | chr1:18672828-18677365 FORWARD Length = 982 Score = 112 bits (280), Expect = 4e-026 Identities = 50/53 (94%), Positives = 51/53 (96%) Frame = -1 Query: 161 KNHRTQVARACWGLRAKRRWCLSGTPIQNAIDDLYSYFRFLRYDPYAVYKSFC 3 KNHRTQVARAC GLRAKRRWCLSGTPIQN IDDLYSYFRFL+YDPYAVYKSFC Sbjct: 483 KNHRTQVARACCGLRAKRRWCLSGTPIQNTIDDLYSYFRFLKYDPYAVYKSFC 535 >TAIR9_protein||AT1G61140.1 | Symbols: EDA16 | EDA16 (embryo sac development arrest 16); ATP binding / DNA binding / helicase/ nucleic acid binding / protein binding / zinc ion binding | chr1:22535038-22540610 REVERSE Length = 1281 Score = 106 bits (263), Expect = 4e-024 Identities = 45/53 (84%), Positives = 50/53 (94%) Frame = -1 Query: 161 KNHRTQVARACWGLRAKRRWCLSGTPIQNAIDDLYSYFRFLRYDPYAVYKSFC 3 KN++TQVARACWGLRAKRRWCLSGTPIQN+IDDLYSYFRFL+YDPY+ Y FC Sbjct: 799 KNYKTQVARACWGLRAKRRWCLSGTPIQNSIDDLYSYFRFLKYDPYSSYVLFC 851 >TAIR9_protein||AT1G61140.2 | Symbols: EDA16 | EDA16 (embryo sac development arrest 16); ATP binding / DNA binding / helicase/ protein binding / zinc ion binding | chr1:22536293-22540610 REVERSE Length = 1023 Score = 106 bits (263), Expect = 4e-024 Identities = 45/53 (84%), Positives = 50/53 (94%) Frame = -1 Query: 161 KNHRTQVARACWGLRAKRRWCLSGTPIQNAIDDLYSYFRFLRYDPYAVYKSFC 3 KN++TQVARACWGLRAKRRWCLSGTPIQN+IDDLYSYFRFL+YDPY+ Y FC Sbjct: 806 KNYKTQVARACWGLRAKRRWCLSGTPIQNSIDDLYSYFRFLKYDPYSSYVLFC 858 >TAIR9_protein||AT1G61140.3 | Symbols: EDA16 | EDA16 (embryo sac development arrest 16); ATP binding / DNA binding / helicase/ nucleic acid binding / protein binding / zinc ion binding | chr1:22535038-22539756 REVERSE Length = 1123 Score = 106 bits (263), Expect = 4e-024 Identities = 45/53 (84%), Positives = 50/53 (94%) Frame = -1 Query: 161 KNHRTQVARACWGLRAKRRWCLSGTPIQNAIDDLYSYFRFLRYDPYAVYKSFC 3 KN++TQVARACWGLRAKRRWCLSGTPIQN+IDDLYSYFRFL+YDPY+ Y FC Sbjct: 641 KNYKTQVARACWGLRAKRRWCLSGTPIQNSIDDLYSYFRFLKYDPYSSYVLFC 693 >TAIR9_protein||AT3G20010.1 | Symbols: | SNF2 domain-containing protein / helicase domain-containing protein / RING finger domain-containing protein | chr3:6971352-6976340 FORWARD Length = 1048 Score = 102 bits (254), Expect = 4e-023 Identities = 46/52 (88%), Positives = 49/52 (94%) Frame = -1 Query: 161 KNHRTQVARACWGLRAKRRWCLSGTPIQNAIDDLYSYFRFLRYDPYAVYKSF 6 KN+RTQ+AR+C LRAKRRWCLSGTPIQN IDDLYSYFRFLRYDPYAVYKSF Sbjct: 554 KNYRTQMARSCCTLRAKRRWCLSGTPIQNTIDDLYSYFRFLRYDPYAVYKSF 605 >TAIR9_protein||AT1G11100.1 | Symbols: | SNF2 domain-containing protein / helicase domain-containing protein / zinc finger protein-related | chr1:3703934-3709302 REVERSE Length = 1227 Score = 92 bits (227), Expect = 6e-020 Identities = 39/53 (73%), Positives = 47/53 (88%) Frame = -1 Query: 161 KNHRTQVARACWGLRAKRRWCLSGTPIQNAIDDLYSYFRFLRYDPYAVYKSFC 3 KN++TQ + AC GL AKRRWCLSGTPIQN+I DLYSYFRFL+YDPY+ Y++FC Sbjct: 726 KNYKTQASIACSGLHAKRRWCLSGTPIQNSIADLYSYFRFLKYDPYSSYQTFC 778 >TAIR9_protein||AT3G16600.1 | Symbols: | SNF2 domain-containing protein / helicase domain-containing protein / RING finger domain-containing protein | chr3:5652839-5655670 REVERSE Length = 639 Score = 92 bits (227), Expect = 6e-020 Identities = 39/52 (75%), Positives = 46/52 (88%) Frame = -1 Query: 161 KNHRTQVARACWGLRAKRRWCLSGTPIQNAIDDLYSYFRFLRYDPYAVYKSF 6 KNHRT +A+AC+ LRAKRRWCL+GTPI+N +DDLYSYFRFLRY PYA+ SF Sbjct: 225 KNHRTLIAKACFSLRAKRRWCLTGTPIKNKVDDLYSYFRFLRYHPYAMCNSF 276 >TAIR9_protein||AT5G22750.1 | Symbols: RAD5 | RAD5; ATP binding / ATP-dependent helicase/ DNA binding / helicase/ hydrolase, acting on acid anhydrides, in phosphorus-containing anhydrides / nucleic acid binding / protein binding / zinc ion binding | chr5:7565374-7570871 REVERSE Length = 1030 Score = 61 bits (147), Expect = 1e-010 Identities = 26/49 (53%), Positives = 36/49 (73%) Frame = -1 Query: 161 KNHRTQVARACWGLRAKRRWCLSGTPIQNAIDDLYSYFRFLRYDPYAVY 15 KN ++Q++ A L A RRWCL+GTPIQN ++DLYS RFLR +P+ + Sbjct: 579 KNSKSQISLAAAALVADRRWCLTGTPIQNNLEDLYSLLRFLRIEPWGTW 627 >TAIR9_protein||AT1G05120.1 | Symbols: | SNF2 domain-containing protein / helicase domain-containing protein / RING finger domain-containing protein | chr1:1471624-1476067 REVERSE Length = 834 Score = 57 bits (137), Expect = 2e-009 Identities = 27/53 (50%), Positives = 34/53 (64%), Gaps = 2/53 (3%) Frame = -1 Query: 161 KNHRTQVARACWGLRAKRRWCLSGTPIQNAIDDLYSYFRFLRYDPYAVYKSFC 3 K R+ ARA + L A RW LSGTP+QN + +LYS RFL+ PY+ Y FC Sbjct: 366 KERRSNTARAVFALEATYRWALSGTPLQNRVGELYSLIRFLQIRPYSYY--FC 416 >TAIR9_protein||AT5G05130.1 | Symbols: | SNF2 domain-containing protein / helicase domain-containing protein / RING finger domain-containing protein | chr5:1512173-1514918 FORWARD Length = 863 Score = 54 bits (127), Expect = 2e-008 Identities = 23/48 (47%), Positives = 32/48 (66%) Frame = -1 Query: 161 KNHRTQVARACWGLRAKRRWCLSGTPIQNAIDDLYSYFRFLRYDPYAV 18 KN Q +R L+A RRW ++GTPIQN DLYS FLR++P+++ Sbjct: 424 KNANAQQSRVVCKLKASRRWAVTGTPIQNGSFDLYSLMAFLRFEPFSI 471 >TAIR9_protein||AT5G43530.1 | Symbols: | SNF2 domain-containing protein / helicase domain-containing protein / RING finger domain-containing protein | chr5:17489327-17494830 FORWARD Length = 1278 Score = 53 bits (125), Expect = 4e-008 Identities = 22/46 (47%), Positives = 33/46 (71%) Frame = -1 Query: 161 KNHRTQVARACWGLRAKRRWCLSGTPIQNAIDDLYSYFRFLRYDPY 24 K+ +TQ A+A + L + RWCL+GTP+QN ++DLYS FL +P+ Sbjct: 828 KSWKTQAAKATFELSSHCRWCLTGTPLQNKLEDLYSLLCFLHVEPW 873 >TAIR9_protein||AT1G02670.1 | Symbols: | DNA repair protein, putative | chr1:576046-580299 FORWARD Length = 679 Score = 49 bits (116), Expect = 4e-007 Identities = 25/54 (46%), Positives = 35/54 (64%), Gaps = 3/54 (5%) Frame = -1 Query: 161 KNHRTQVARACWGLRAKRRWCLSGTPIQNAIDDLYSY--FRFLRYDPYAVYKSF 6 KN ++ A+A + L A RW LSGTP+QN +D+LYS + FL + Y+ Y SF Sbjct: 281 KNRSSRTAKAVFALEATYRWALSGTPLQNDVDELYSLVSYSFLNFF-YSTYASF 333 >TAIR9_protein||AT2G40770.1 | Symbols: | ATP binding / DNA binding / helicase/ nucleic acid binding / protein binding / zinc ion binding | chr2:17013535-17021315 REVERSE Length = 1665 Score = 45 bits (106), Expect = 6e-006 Identities = 17/35 (48%), Positives = 25/35 (71%) Frame = -1 Query: 122 LRAKRRWCLSGTPIQNAIDDLYSYFRFLRYDPYAV 18 L K RWC++GTPIQ +DDL+ +FL+ +P+ V Sbjct: 625 LYTKHRWCITGTPIQRKLDDLFGLLKFLKANPFDV 659 Database: TAIR9 protein Posted date: Wed Jul 08 15:16:08 2009 Number of letters in database: 13,468,323 Number of sequences in database: 33,410 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 2,726,080,741 Number of Sequences: 33410 Number of Extensions: 2726080741 Number of Successful Extensions: 136295362 Number of sequences better than 0.0: 0 |