BLASTX 7.6.2 Query= RU14892 /QuerySize=158 (157 letters) Database: TAIR9 protein; 33,410 sequences; 13,468,323 total letters Score E Sequences producing significant alignments: (bits) Value TAIR9_protein||AT2G02090.1 | Symbols: CHR19, CHA19, ETL1 | ETL1;... 100 3e-022 >TAIR9_protein||AT2G02090.1 | Symbols: CHR19, CHA19, ETL1 | ETL1; ATP binding / DNA binding / helicase/ nucleic acid binding | chr2:523481-526884 FORWARD Length = 764 Score = 100 bits (247), Expect = 3e-022 Identities = 44/48 (91%), Positives = 47/48 (97%) Frame = +1 Query: 1 RHSAQQKDDRKILKRWQWSCVLMDEAHALKDKNSYRWKNLMSVARSAN 144 RHS QQKDDRK+LKRW+WSCVLMDEAHALKDKNSYRWKNLMSVAR+AN Sbjct: 330 RHSEQQKDDRKVLKRWRWSCVLMDEAHALKDKNSYRWKNLMSVARNAN 377 Database: TAIR9 protein Posted date: Wed Jul 08 15:16:08 2009 Number of letters in database: 13,468,323 Number of sequences in database: 33,410 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 2,726,080,741 Number of Sequences: 33410 Number of Extensions: 2726080741 Number of Successful Extensions: 136295362 Number of sequences better than 0.0: 0 |