BLASTX 7.6.2 Query= RU15139 /QuerySize=235 (234 letters) Database: TAIR9 protein; 33,410 sequences; 13,468,323 total letters Score E Sequences producing significant alignments: (bits) Value TAIR9_protein||AT1G17410.1 | Symbols: | nucleoside diphosphate ... 64 1e-011 >TAIR9_protein||AT1G17410.1 | Symbols: | nucleoside diphosphate kinase family protein | chr1:5968627-5969780 REVERSE Length = 182 Score = 64 bits (155), Expect = 1e-011 Identities = 28/53 (52%), Positives = 42/53 (79%) Frame = +2 Query: 68 CRCDGITEKEKTLAIIKPDGMSGNYSEKIKNAILDSGFTILKEMTIQLDEDAA 226 C G + +E+TLA+IKPDG+SGNY+E+IK ++++GF I+KEM QLD++ A Sbjct: 24 CLGYGASSEERTLAMIKPDGVSGNYTEEIKTIVVEAGFNIVKEMLTQLDKETA 76 Database: TAIR9 protein Posted date: Wed Jul 08 15:16:08 2009 Number of letters in database: 13,468,323 Number of sequences in database: 33,410 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 2,786,097,356 Number of Sequences: 33410 Number of Extensions: 2786097356 Number of Successful Extensions: 141287952 Number of sequences better than 0.0: 0 |