BLASTX 7.6.2 Query= RU15188 /QuerySize=231 (230 letters) Database: TAIR9 protein; 33,410 sequences; 13,468,323 total letters Score E Sequences producing significant alignments: (bits) Value TAIR9_protein||AT4G24440.1 | Symbols: | transcription initiatio... 70 2e-013 TAIR9_protein||AT4G24440.2 | Symbols: | transcription initiatio... 70 2e-013 >TAIR9_protein||AT4G24440.1 | Symbols: | transcription initiation factor IIA gamma chain / TFIIA-gamma (TFIIA-S) | chr4:12633460-12634553 FORWARD Length = 107 Score = 70 bits (170), Expect = 2e-013 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = -1 Query: 110 MATFELYRRSTIGMCLTETLDEMVQNATLSPELAIQ 3 MATFELYRRSTIGMCLTETLDEMVQ+ TLSPELAIQ Sbjct: 1 MATFELYRRSTIGMCLTETLDEMVQSGTLSPELAIQ 36 >TAIR9_protein||AT4G24440.2 | Symbols: | transcription initiation factor IIA gamma chain / TFIIA-gamma (TFIIA-S) | chr4:12633460-12634553 FORWARD Length = 107 Score = 70 bits (170), Expect = 2e-013 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = -1 Query: 110 MATFELYRRSTIGMCLTETLDEMVQNATLSPELAIQ 3 MATFELYRRSTIGMCLTETLDEMVQ+ TLSPELAIQ Sbjct: 1 MATFELYRRSTIGMCLTETLDEMVQSGTLSPELAIQ 36 Database: TAIR9 protein Posted date: Wed Jul 08 15:16:08 2009 Number of letters in database: 13,468,323 Number of sequences in database: 33,410 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 2,786,097,356 Number of Sequences: 33410 Number of Extensions: 2786097356 Number of Successful Extensions: 141287952 Number of sequences better than 0.0: 0 |