BLASTX 7.6.2 Query= RU15263 /QuerySize=686 (685 letters) Database: TAIR9 protein; 33,410 sequences; 13,468,323 total letters Score E Sequences producing significant alignments: (bits) Value TAIR9_protein||AT5G25520.2 | Symbols: | transcription elongatio... 48 6e-006 TAIR9_protein||AT5G11430.1 | Symbols: | zinc ion binding | chr5... 47 1e-005 >TAIR9_protein||AT5G25520.2 | Symbols: | transcription elongation factor-related | chr5:8885550-8889484 FORWARD Length = 998 Score = 48 bits (112), Expect = 6e-006 Identities = 17/28 (60%), Positives = 25/28 (89%) Frame = -2 Query: 684 EVPPGFGPPSSRDDDDLPEFNYSGASNP 601 ++PPGFGP +++DDDDLPEFN++ +S P Sbjct: 864 DMPPGFGPVAAKDDDDLPEFNFNSSSGP 891 >TAIR9_protein||AT5G11430.1 | Symbols: | zinc ion binding | chr5:3648469-3652256 FORWARD Length = 874 Score = 47 bits (110), Expect = 1e-005 Identities = 21/33 (63%), Positives = 27/33 (81%), Gaps = 1/33 (3%) Frame = -2 Query: 684 EVPPGFGPPSSRDDDDLPEFNYSGASNP-SVPQ 589 +VPPGFGP +SRD+DDLPEFN++ + P S PQ Sbjct: 750 DVPPGFGPVASRDEDDLPEFNFNSSVVPVSSPQ 782 Database: TAIR9 protein Posted date: Wed Jul 08 15:16:08 2009 Number of letters in database: 13,468,323 Number of sequences in database: 33,410 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 2,786,097,356 Number of Sequences: 33410 Number of Extensions: 2786097356 Number of Successful Extensions: 141287952 Number of sequences better than 0.0: 0 |